[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56459.1"

            "similar to Arginyl-tRNA synthetase"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPEADRGRDTFAVLPGTPHIRPCTGAHMAMTALSFAAATPRYLSDLIRHACTEATGIPAA:Sequence 61: . . . * . .: 120 :HLPDAPLRRSTDQPGQYLSPLPSRLAGRLGRAARDLAADITAVLRNQPHLTDVQVTGPGF:Sequence : XXXXXXXXXXXXXXXX :SEG|84->99|rlagrlgraardlaad 121: . . + . . .: 180 :VAVTPVPSMRAALAQLVADAPAAFLLDLAVPGVAHQPGPPPDGWALSDLAHARDSGQLRD:Sequence : XXXXXXXXXXXXXXXXXXXXX :SEG|131->151|aalaqlvadapaaflldlavp : XX:SEG|179->213|rdwaradarrriaaaadpatapaaaaaltrqppad 181: . * . . . .: 240 :WARADARRRIAAAADPATAPAAAAALTRQPPADWRDVPQDNTATEAAQLLTVIGEAAARV:Sequence :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|179->213|rdwaradarrriaaaadpatapaaaaaltrqppad : XXXXX:SEG|236->247|aaarvaacrsaa 241: + . . . . *: 300 :AACRSAADQVRPQETTGPDLPARPSPHAPGAWARATAANPAFALRYAHAHAHTAVHHWAA:Sequence :XXXXXXX :SEG|236->247|aaarvaacrsaa : XXXXXXXXXXXXXX:SEG|287->300|ahahahtavhhwaa 301: . . . . + .: 360 :QLGLRRLGTRRRHTADEVAALTTPAAEALLGTLFDGPAALRAAARRHQPHILVRYLESLA:Sequence : XXXXXXXXXXX :SEG|302->312|lglrrlgtrrr : XXXXXXXXXXXXXXX :SEG|319->333|aalttpaaeallgtl : ======================:RP:SCP|339->374|1iq0A1|1e-07|30.6|36/126|a.27.1.1 : ========================:BL:SWS|337->374|SYR_PSYCK|7e-07|47.4|38/609 : $$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|337->373|PF05746|6e-05|45.9|37/118|DALR_1 361: . . . * . .: 420 :AAYHEWWESHSVLPGHEGTADTHTTTVAARLDLCAAAAGVLRAGLLLIGVSAPTRL :Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|388->409|aarldlcaaaagvlraglllig :============== :RP:SCP|339->374|1iq0A1|1e-07|30.6|36/126|a.27.1.1 :============== :BL:SWS|337->374|SYR_PSYCK|7e-07|47.4|38/609 :$$$$$$$$$$$$$ :RP:PFM|337->373|PF05746|6e-05|45.9|37/118|DALR_1