[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56467.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------111-------1------1------11-------1--------1---332--1----2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---1--11111111111111111111111111111-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------1----1111-111111-------111-------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKSVDPSTVSIRRRSAVLLSSAAALFLALSSSTAHADPDEPSLEELNERIAALEEEYDA:Sequence : XXXXXXXXXXXXXXXXXXXX :SEG|16->35|savllssaaalflalsssta 61: . . . * . .: 120 :ELVQYTSAKEEVERATEELEEIEEKLEAARDDVALIAASQYKSSGFDPVIEVMVSRSPDE:Sequence : XXXXXXXXXXXXXXXXXXXXXXX :SEG|68->90|akeeverateeleeieekleaar 121: . . + . . .: 180 :VLSDVALITQVSHINGERVSHLSELKEEAEQAKEEAEAKLAEAEELVEELEAQRDEVLAK:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|144->172|elkeeaeqakeeaeaklaeaeelveelea 181: . * . . . .: 240 :IEEYESEQVPVTTGTGSIPESARGWGFDGATPRMAAIRDEIIRKFGAPYPVGCLRPGDPG:Sequence 241: + . . . . *: 300 :EHGSGRACDFMMSAGGAMPSAANRELGWQIAEYAKANADRLGVMYVIWEQKIWDSRNPGA:Sequence : XXXXXXXXXXXX :SEG|251->262|mmsaggampsaa 301: . . . . + .: 360 :GWKPMADRGSITQNHYDHVHISSW :Sequence