[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56580.1"

            "phosphoribosylaminoimidazole carboxylase"
            ""

OrgPattern ------1211111111-111111-11111111---1-111111------------1--1-1111--11 1-11111111111111111-111111111111111111111---1111111111111111111111111111111111----112-11---1-------11111111111--------------------1---1-11111---11111111111111212211211111111211111111111111---1111111111111111111111111111111111111111111111111111111111111121111111-1-11111112111111111111111111111111111111111111111111111111111111-------------------------1---1-------1--11-1---1-1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------1111-1111111111111111111111111111111111111111111111111111111111111111111111111111------1---------1----111----11-------------------------1-11111111111111111111-111111--1-11-1-111------11111111111111111-111111111111111111-1111111111111111111111111111111111111111111111--11-----111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111--111111------------------------------------1----1-1111-- ----111-----1111111111111111111211111111111111111111111111111111111111111111111111111111-1111111111111111--12-------------------------------------------------------------------11181111121121121111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSETNRTVPVVGMVGGGQLARMTHQAAIALGVDFRVLAARPTDSAARVVADVHLGDDRGR:Sequence : EEEEEccccccHHHHHHHHHHTcEEEEEcccTcGGGcGGGccEEEcccccH:Sec Str : XXXXXXX:SEG|54->64|lgddrgrddll : =========================================================:BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429 61: . . . * . .: 120 :DDLLAFAKDSDVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGA:Sequence :HHHHHHHHHHccHHHHHHHHHHHHTTHHHHHTcEEcccHHHHHHHHcHHHHHHHHHHTTc:Sec Str :XXXX :SEG|54->64|lgddrgrddll : ==============:RP:SCP|107->308|1b6rA3|2e-22|27.7|191/192|d.142.1.2 :============================================================:BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429 : $$$$:RP:PFM|117->285|PF02222|7e-25|40.4|166/171|ATP-grasp 121: . . + . . .: 180 :PCPRWRGITSLDEVTEFAGQTGWPVVLKAARGGYDGKGVWVVGDAAEAAAVVERAAREQV:Sequence :ccccEEEEccHHHHHHHHHHHcccEEEEEETTccTTTTcEEEHHHHHHHHHHHHHHcTTc:Sec Str : XXXXXXXXXXXXXX :SEG|165->178|aaeaaavveraare :============================================================:RP:SCP|107->308|1b6rA3|2e-22|27.7|191/192|d.142.1.2 :============================================================:BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|117->285|PF02222|7e-25|40.4|166/171|ATP-grasp 181: . * . . . .: 240 :PLLVEEKIAFRRELAVQVARSPYGQVAAYPVVETVQRGGICHEVIAPAPHLSEDRAVAAQ:Sequence :cEEEEEccTTcEEEEEEEEEcTTccEEEEEEEEEcccTTcGccEEEccccccHHHHHHHH:Sec Str : XXXXX:SEG|236->258|avaaqelaielaaaldvvgllav :============================================================:RP:SCP|107->308|1b6rA3|2e-22|27.7|191/192|d.142.1.2 :============================================================:BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|117->285|PF02222|7e-25|40.4|166/171|ATP-grasp 241: + . . . . *: 300 :ELAIELAAALDVVGLLAVELFETDTGVVVNELAMRPHNSGHWTIDGACTSQFEQHLRAVL:Sequence :HHHHHHHHHHTcccEEEEEEETTTccEEEEEEEccccHHHHHHHHHHcccHHHHHHHHHT:Sec Str :XXXXXXXXXXXXXXXXXX :SEG|236->258|avaaqelaielaaaldvvgllav :============================================================:RP:SCP|107->308|1b6rA3|2e-22|27.7|191/192|d.142.1.2 :============================================================:BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|117->285|PF02222|7e-25|40.4|166/171|ATP-grasp 301: . . . . + .: 360 :DLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEVRPGRKIGHVT:Sequence :TccGGGcccTTTTTccccccccccccEEEEccEEEEEccGGGcTTcccccccccccEEEE:Sec Str :======== :RP:SCP|107->308|1b6rA3|2e-22|27.7|191/192|d.142.1.2 : ===============================================:RP:SCP|314->365|1eyzA1|4e-10|17.3|52/74|b.84.2.1 :============================================================:BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429 361: . . . * . .: 420 :VVGDDPEALLERARTAAAYLKGDAQ :Sequence :EEEccH :Sec Str : XXXXXXXXXXXX :SEG|367->378|eallerartaaa :===== :RP:SCP|314->365|1eyzA1|4e-10|17.3|52/74|b.84.2.1 :===== :BL:SWS|4->365|PURK_MYCTU|5e-88|58.0|362/429