[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56592.1"

            "dihydrolipoamide dehydrogenase"
            ""

OrgPattern 22211276666777662432311551122561222222111122212121333333314323542--- 44568433556433A6777-99119777777365554BDD34456645455266C4533355F565A765213332221-123231114442-422122222273432321111111111111132312222222333313111434444334123322222322245474222222222222422442311555555554535565455744555553425387655555574444444444444445967463715413322CE442445786355564464445654444334444444444444444445554445554424-4444444345327331122522-23-1-164152435445545134227733633333576443453333455555455555-455576486953677598B89A884C9766764544675333333335333464422322222221122222222222222222164672765586887787555577466666378666A893345447388656763477412233333333357375326834544467443-32425635233434415111-------------------213675557A54535722222252422322223341-1774611111153445435556566655-55555655455654545556564433344544654553755456444444531444444444444113311111445436855222222222222222756474655533777866554868955445444453443546644444636554334534222222222424433331---11--21422213-1-42111222132122---2222331343741 4411226-C5512322222132323232222222212222222221323335582223222222222222222233323322222222-53222222222222525-49476746665344574FD1G2N*9-A6J3331A54763453353393976769E35521533765654664*34455676B294AA88679 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYV:Sequence :cEEEEEEcccHHHHHHHHHHHHTTccEEEEEccccccHHHHHHcHHHHHHHHHHHHHHHH:Sec Str : ============================== :RP:SCP|3->32|1cl0A1|6e-08|40.0|30/190|c.3.1.5 : ============================================ :RP:SCP|3->46|1yrwA2|4e-07|15.9|44/197|c.65.1.1 : ===========================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->307|PF07992|1e-24|41.8|263/275|Pyr_redox_2 61: . . . * . .: 120 :KEAATLGINVGNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARL:Sequence :HHHGHHHTccGGGTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEE:Sec Str :============================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->307|PF07992|1e-24|41.8|263/275|Pyr_redox_2 121: . . + . . .: 180 :VDPHIVAVGDERIRADVVLIATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGS:Sequence :EETTEEEEEEEEEEETTEEEEEEEEEEcccccccccTTEEcHHHHTTccccccEEEEEcc:Sec Str : =======================================================:RP:SCP|126->331|1gv4A1|3e-29|17.2|204/224|c.3.1.5 :============================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->307|PF07992|1e-24|41.8|263/275|Pyr_redox_2 181: . * . . . .: 240 :GVTGAEFANAYQALGSDVTLVSSRDRVMPTQDADAARVLEDVFARRGMTVLGNSRAESVT:Sequence :cHHHHHHHHHHHHHTcEEEEEcccccccTTccHHHHHHHHHHHGGGEEEEEcccEEEEEE:Sec Str :============================================================:RP:SCP|126->331|1gv4A1|3e-29|17.2|204/224|c.3.1.5 :============================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->307|PF07992|1e-24|41.8|263/275|Pyr_redox_2 241: + . . . . *: 300 :RTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAGIRLDERGFVQVDRVSRTSTP:Sequence :EETTEEEEEEcccccEEEccEEEcccEEEcGGGTTGGGTTccccTTccccccTTcccccT:Sec Str :============================================================:RP:SCP|126->331|1gv4A1|3e-29|17.2|204/224|c.3.1.5 :============================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->307|PF07992|1e-24|41.8|263/275|Pyr_redox_2 301: . . . . + .: 360 :GVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHPELAAVGATED:Sequence :TEEEcGGGTcccccHHHHHHHHHHHHHHHTTcccccccccccEEEEcccccEEEEEccHH:Sec Str :=============================== :RP:SCP|126->331|1gv4A1|3e-29|17.2|204/224|c.3.1.5 : ======================:RP:SCP|339->455|1xdiA2|8e-33|60.7|117/118|d.87.1.1 :============================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$ :RP:PFM|4->307|PF07992|1e-24|41.8|263/275|Pyr_redox_2 : $$$$$$$$$$$$$$$$$$$:RP:PFM|342->450|PF02852|3e-20|42.2|109/110|Pyr_redox_dim 361: . . . * . .: 420 :DVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV:Sequence :HHHHHTccEEEEEEEGGGcHHHHHTTccccEEEEEEETTTccEEEEEEEcTTHHHHHHHH:Sec Str :============================================================:RP:SCP|339->455|1xdiA2|8e-33|60.7|117/118|d.87.1.1 :============================================================:BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|342->450|PF02852|3e-20|42.2|109/110|Pyr_redox_dim 421: . . + . . .: 480 :SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQGFPE :Sequence :HHHHHTTccHHHHHTccccccccTTHHHHHHHHHHTcHHH :Sec Str :=================================== :RP:SCP|339->455|1xdiA2|8e-33|60.7|117/118|d.87.1.1 :======================================= :BL:SWS|2->459|DLDH1_BACSU|2e-65|34.8|448/470 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|342->450|PF02852|3e-20|42.2|109/110|Pyr_redox_dim