[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56646.1"

            "SSU ribosomal protein S9P"
RS9_THEFY   "RecName: Full=30S ribosomal protein S9;"

OrgPattern -------------------------------------------------------------------- ----111111111111111-111111111111111111111111111111111111111111111111111111111111111-----111111111---1---1--1--11111111--1111-------------1111---1111111111111111111111-111111111111111111-11--111111111111111111111111111-1111111111111-1-1111111111111111111111111111111111111-111-11111111111111111111111111111111111111-11111111111111111111111111111111111111111111-11211111111-11-1111-11111111111111111111111111111-11111111111111111111111111111111111111111111111111111-111------------11--------------11111111111111111111111111111111111111111111111111-11111-11-11-11111111111111-1-111111111111111111111111111--------------------------1111--1111-1111111111111111111111--11---1-11111111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111111111111111111111111111-111111111-1111----1111-------------11111111-11----------------11------111-1---1-1-11---11---1----------11111111111111-- ------1--------------------------------------------------------11-------1-1-1---111111---------------------------------------------------------------------------------------1-----6111-12243-11-1-1111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVEPTGIEDVQEYDENSEEYPAEYTTETPETVGETYIPTAVGPSLGTGRRKTAVARVRVV:Sequence : ccccEETTEEEEEEEE:Sec Str : XXXXXXXXXXXXXX :SEG|18->31|eeypaeyttetpet : XXXXXXXXXXXX:SEG|49->60|rrktavarvrvv : ===============:RP:SCP|46->169|1fjgI|6e-27|35.0|123/127|d.14.1.1 :============================================================:BL:SWS|1->169|RS9_THEFY|2e-61|100.0|169/169 61: . . . * . .: 120 :PGTGEWKINGKSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHG:Sequence :EccccEEETTEEHHHHccccGGGTTTcHHHHTTTcTTTEEEEEEEEcccHHHHHHHHHHH:Sec Str : XXXXXXX:SEG|114->127|agalrhglaralaa : ##############:PROS|107->125|PS00360|RIBOSOMAL_S9|PDOC00311| :============================================================:RP:SCP|46->169|1fjgI|6e-27|35.0|123/127|d.14.1.1 :============================================================:BL:SWS|1->169|RS9_THEFY|2e-61|100.0|169/169 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|61->169|PF00380|1e-16|43.5|108/121|Ribosomal_S9 121: . . + . . .: 180 :LARALAAMDPEHNRPPLKKAGFLTRDARKVERKKAGLKKARKAPQYSKR :Sequence :HHHHTTTccGGEGcHHHHTTTcccccccccccccTTcccTTcccccccc :Sec Str :XXXXXXX :SEG|114->127|agalrhglaralaa : XXXXXXXXXXXX :SEG|152->163|rkkaglkkarka :##### :PROS|107->125|PS00360|RIBOSOMAL_S9|PDOC00311| :================================================= :RP:SCP|46->169|1fjgI|6e-27|35.0|123/127|d.14.1.1 :================================================= :BL:SWS|1->169|RS9_THEFY|2e-61|100.0|169/169 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|61->169|PF00380|1e-16|43.5|108/121|Ribosomal_S9