[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56646.1 tfus0 AAZ56646.1 "SSU ribosomal protein S9P"
MVEPTGIEDVQEYDENSEEYPAEYTTETPETVGETYIPTAVGPSLGTGRRKTAVARVRVV
PGTGEWKINGKSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQAGALRHG
LARALAAMDPEHNRPPLKKAGFLTRDARKVERKKAGLKKARKAPQYSKR
//