[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56713.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----21-2---11-----------------------1-------4--2----11-21------21123321-----------------------------------------------------------------------------------------------1-----------------------------------------------1------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAPRLGIQELIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGA:Sequence : EEccccccccHHHHHHHHHHHHHHTTccccEEEcccHHHHHHHHHHHHcccccc:Sec Str : ====================================================:RP:SCP|9->74|1pm3A|5e-06|19.0|63/69|b.41.1.2 61: . . . * . .: 120 :EVTEQDLRVPFSKKMIKDSPRFETGGHLSPEQEAQLYEHYGVRPKVPGPRGDVEGVAEQE:Sequence :cEEEEcGGGHHHHHHHHHHTTccccEEEEccHHHHHH :Sec Str :============== :RP:SCP|9->74|1pm3A|5e-06|19.0|63/69|b.41.1.2 121: . . + . . .: 180 :RAQQKEETSMTVSEERARIGVERTESGHARVHKTVEREEFEQDVPVRREELRIEREPVTG:Sequence : :Sec Str : ========================================================:BL:SWS|125->229|YSNF_BACSU|2e-11|30.8|104/273 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|134->230|PF09557|1e-10|51.5|97/112|DUF2382 181: . * . . . .: 240 :EEQAAATDRIGEQDQEITLHEERAVVGKEEVPVERVRISKEEVTDTERVKGELRKEHLEV:Sequence : :Sec Str : XXXXXXXXX:SEG|232->246|elrkehleveeeeee :================================================= :BL:SWS|125->229|YSNF_BACSU|2e-11|30.8|104/273 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|134->230|PF09557|1e-10|51.5|97/112|DUF2382 241: + . . . . *: 300 :EEEEEEGP :Sequence : :Sec Str :XXXXXX :SEG|232->246|elrkehleveeeeee