[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56713.1 tfus0 AAZ56713.1 "conserved hypothetical protein"
MAPRLGIQELIGHKLIDQDGHSVGKIGQVYRDDQTQEPTWVTVHTGMFGHQESFVPLVGA
EVTEQDLRVPFSKKMIKDSPRFETGGHLSPEQEAQLYEHYGVRPKVPGPRGDVEGVAEQE
RAQQKEETSMTVSEERARIGVERTESGHARVHKTVEREEFEQDVPVRREELRIEREPVTG
EEQAAATDRIGEQDQEITLHEERAVVGKEEVPVERVRISKEEVTDTERVKGELRKEHLEV
EEEEEEGP
//