[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56815.1"

            "DNA polymerase III delta prime subunit"
            ""

OrgPattern -------------------------------------------------------------------- 2221222222222222222-222222222222222222222222222222222222222222222222222222222222222212221111-1111--111---11121111111111111112111-11111-12212222222124-11121111111111-112311112111111111212112222222222222222222422222222222224221222222222222222222222222222222212212222222222222---11122221112222222222222222222122112222112221111122111111111-1-2-1111112-2--2222222222122222222111111-1111--1-211---12----122222222222-11-11---1---1--111-111----12-111-1--21122222222122221121111111111111111111111112---1121112111111111111111122111111111112222112222122222222111212122122222221111122222222212222112222222222212222211-111111111111-1111111-1112222222221122222212222222222222-2222212-1111-222121111111111-1111111111111111111111212212122222222222222111111112-2222222222221122111112222222222222222222222221111112111222222222212222122211111111122222222222222222222222221111112111111111111111111-1--1--11-1-----1---211111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----2-----------------------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSVFDTLVGQDTVVQRLRAAVRAADNLLSGGDGTGMTHAWLFTGPPGAGRAQAARAFAAA:Sequence : cEEEEEccTTccHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|13->24|vvqrlraavraa : XXXXXXXXXXXXXX:SEG|47->60|gagraqaarafaaa : =========================:RP:SCP|36->183|1jr3A2|5e-27|32.0|147/240|c.37.1.20 61: . . . * . .: 120 :LQCTHGGCGECASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVL:Sequence :HTccTccHHHHHHHHHHHTTccccEEEEcGGGcTTcHHHHHHHHTTccEEEEEEETTEEE:Sec Str :============================================================:RP:SCP|36->183|1jr3A2|5e-27|32.0|147/240|c.37.1.20 : =====================================================:BL:SWS|68->190|HOLB_HAEIN|3e-18|36.6|123/327 121: . . + . . .: 180 :FEDADRATEAASNALLKAIEEPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAII:Sequence :EEETTTEEEcTTTcEEEEEcTTccEEEEEccccEEEEEcTTcccEEEEEEGGGHHHHHHH:Sec Str :============================================================:RP:SCP|36->183|1jr3A2|5e-27|32.0|147/240|c.37.1.20 :============================================================:BL:SWS|68->190|HOLB_HAEIN|3e-18|36.6|123/327 181: . * . . . .: 240 :DALVTRDGIDRDRAVAAARAAAGHLERARQLATDETARARREEVLTIPARLDSLGACVHA:Sequence :TTc :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|191->209|rdravaaaraaaghlerar :=== :RP:SCP|36->183|1jr3A2|5e-27|32.0|147/240|c.37.1.20 :========== :BL:SWS|68->190|HOLB_HAEIN|3e-18|36.6|123/327 241: + . . . . *: 300 :AARLYEIAEADAKESTAALDEQEKADLKAAFGEGATGKGVAKAVRGAAGALKELEERQKR:Sequence : :Sec Str : XXXXXXXXXXXXXXXXXXX :SEG|272->290|gegatgkgvakavrgaaga : =======:RP:SCP|294->383|1a5tA1|7e-09|8.4|83/117|a.80.1.1 301: . . . . + .: 360 :RATRIKRDAYDTFLMDLVAFYRDVLAIQLGASVELSTADRDADLRRVARSSTPEATLRRI:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|338->349|adrdadlrrvar :============================================================:RP:SCP|294->383|1a5tA1|7e-09|8.4|83/117|a.80.1.1 361: . . . * . .: 420 :DAIMECRRRINANVHPQIAMEAMTAALYLG :Sequence : :Sec Str :======================= :RP:SCP|294->383|1a5tA1|7e-09|8.4|83/117|a.80.1.1