[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56815.1 tfus0 AAZ56815.1 "DNA polymerase III delta prime subunit"
MSVFDTLVGQDTVVQRLRAAVRAADNLLSGGDGTGMTHAWLFTGPPGAGRAQAARAFAAA
LQCTHGGCGECASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVL
FEDADRATEAASNALLKAIEEPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAII
DALVTRDGIDRDRAVAAARAAAGHLERARQLATDETARARREEVLTIPARLDSLGACVHA
AARLYEIAEADAKESTAALDEQEKADLKAAFGEGATGKGVAKAVRGAAGALKELEERQKR
RATRIKRDAYDTFLMDLVAFYRDVLAIQLGASVELSTADRDADLRRVARSSTPEATLRRI
DAIMECRRRINANVHPQIAMEAMTAALYLG
//