[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ56988.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAHAPRCPEPSHAARLPGIRRVLLLSGFTFVAWVLGAAAPAFADTLDTLTGAIRHPETAV:Sequence 61: . . . * . .: 120 :AQTTAELTELVDTALTTDRLAPLPLPQTELPVDTALAVDVDQLERTDTPLPPPVESRPAP:Sequence 121: . . + . . .: 180 :TGTGDSPATAAGTAPEAPQPQPTAPAEASGHATAPNHVPAAADDTVEDESGPQPAEPAAP:Sequence : XXXXXXXXXXXXXXXXXXXXXX :SEG|127->148|pataagtapeapqpqptapaea : XXXXXXXXXXXX:SEG|169->193|esgpqpaepaapapaahshapqqgp 181: . * . . . .: 240 :APAAHSHAPQQGPSLTGGIVGDLTDPPAVARRDSVTALTDLSVALPPRHYVADPFFSPD :Sequence :XXXXXXXXXXXXX :SEG|169->193|esgpqpaepaapapaahshapqqgp