[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAZ56988.1 tfus0 AAZ56988.1 "hypothetical protein"
MAHAPRCPEPSHAARLPGIRRVLLLSGFTFVAWVLGAAAPAFADTLDTLTGAIRHPETAV
AQTTAELTELVDTALTTDRLAPLPLPQTELPVDTALAVDVDQLERTDTPLPPPVESRPAP
TGTGDSPATAAGTAPEAPQPQPTAPAEASGHATAPNHVPAAADDTVEDESGPQPAEPAAP
APAAHSHAPQQGPSLTGGIVGDLTDPPAVARRDSVTALTDLSVALPPRHYVADPFFSPD
//