[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tfus0:AAZ57003.1"

            "fructose-6-phosphate phosphoketolase"
            ""

OrgPattern -------------------------------------------------------------------- 1-1-1--2------111----1--11-----1111121111112-111111-111-----111-2-1111111111111--------------------------1------------------111-1---11-1----------12131111111----1--111231------------------11----------------------------------------------------------------11112111112211111211221--111----1---------------------------------------1------------------------------------------------1---1-----1-1112211111-11111111111-23122212211-1---11121112----1------------------111----------------------------------------------------------11--------1------------1--1--1----12-----------111--1------1-----------------1111-----------------------------22--1-1------1111111111111111111---1-----------------------------------------------------------------------------------------------1---------1---1-------------------------1-1111----1--1-11-------------------------------------------------------------------11--1--------------------1---1-- --------------111111222222211111111111111111112222232222112221------------------------11-12-111-22221-1--------------------------------------------------------------------------------------1--1------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTSTESVPRQALTVTELQEIDRYWRAANYLSVGQIYLQDNPLLREPLVPEHIKPRLLGHW:Sequence : cccEEccccTTcccccccEEEEEccEEEcTTcEEEEEEEEEHHHHHHTcccc:Sec Str :============================================================:RP:SCP|1->344|1l8aA1|4e-24|16.1|298/402|c.36.1.10 : ===========================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N 61: . . . * . .: 120 :GTTPGLNFIYAHLNHQIRSRGTEMMWIVGPGHGGPSPVATAWLDGVYSQIYPDVGRNAEG:Sequence :HHHHHHHHHHHHHHHTccccTTcTTcTTccEEEEccGGGHHHHTcccEHHHHHHTTcccc:Sec Str :============================================================:RP:SCP|1->344|1l8aA1|4e-24|16.1|298/402|c.36.1.10 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N 121: . . + . . .: 180 :MRRLFRQFSFPGGVPSHAAPETPGSIHEGGELGYALAHAFGAAFDNPDLVVAAVVGDGEA:Sequence :HHHHTTTTcTTccccccccTTcTTcccccccTTHHHHHHHHHHHccTTcccccccEEEEE:Sec Str : XXXXXXXXXXX:SEG|170->184|vvaavvgdgeaetga : ####### :PROS|148->154|PS60002|PHOSPHOKETOLASE_1|PDOC60002| : ################### :PROS|161->179|PS60003|PHOSPHOKETOLASE_2|PDOC60002| :============================================================:RP:SCP|1->344|1l8aA1|4e-24|16.1|298/402|c.36.1.10 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N 181: . * . . . .: 240 :ETGALSGSWQSIRFLNPARDGAVLPILHLNGYKIAGPTVLARIPEEDLLAQMRGHGYEPH:Sequence :cHHHHHHHHHHHHHHHHTTcTTEEEEEEEccEETTEEGGGGGTccccHHHHHHHHTcEEE:Sec Str :XXXX :SEG|170->184|vvaavvgdgeaetga :============================================================:RP:SCP|1->344|1l8aA1|4e-24|16.1|298/402|c.36.1.10 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N 241: + . . . . *: 300 :VVAGDDPDTVHQLMAGTLASCLERIDTIRFRARQEDGDIANVRWPMIILRTPKGWTGPRA:Sequence :EEccTTTcHHHHHHHHHHHccHHHTccHHHHTTcTTccTTccccEEEEEEccTTTTcTTT:Sec Str :============================================================:RP:SCP|1->344|1l8aA1|4e-24|16.1|298/402|c.36.1.10 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N 301: . . . . + .: 360 :VDGKPVEDTWRSHQVPLAATRENPEHLRLLEEWLRSYRPEELFDEHGAPRPETTTVVPPP:Sequence :TcGGGTcccccHHHHHHHHHHHHHHHHTTccTTccccccHHHHHHHHHHTHHHHHHHHHH:Sec Str : XXXXXXXX:SEG|353->360|tttvvppp :============================================ :RP:SCP|1->344|1l8aA1|4e-24|16.1|298/402|c.36.1.10 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N 361: . . . * . .: 420 :DCRISSSPHANGGLLLRDLLLPDFRDYAVEVERPGVDMVEATRVLGGFLRDVVAANPHNF:Sequence :HHHHHHHHHHHcHHHHHHHHHHTTTcccTTGGGGcccccTTcccEEHHHHHHHTTTcTTE:Sec Str : XXXXXXXX :SEG|374->381|lllrdlll : =======================================:RP:SCP|382->591|1ay0A2|7e-14|15.1|192/197|c.36.1.6 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->390|PF09364|e-143|62.3|374/378|XFP_N : $$$$$$$$$$$$$$$$$$$:RP:PFM|402->578|PF03894|1e-78|74.0|177/179|XFP 421: . . + . . .: 480 :RIMGPDETQSNRLGAVFESTDRAWTTERLPVDQQLSPDGRVMEVLNEQLCQGWLEGYLLT:Sequence :EEEEcccHHHHTcccTTccEEccGGGccETTHHHHETTccEEEcccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|382->591|1ay0A2|7e-14|15.1|192/197|c.36.1.6 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|402->578|PF03894|1e-78|74.0|177/179|XFP 481: . * . . . .: 540 :GRHGLFNSYEAFIHIVDSMVNQHAKWLKVSRELPWRRPISSLNYLLSSHVWRQDHNGFSH:Sequence :cTTEEEEEcEEEEEEEHHHHGGGHHHHHHHHHHTcccHHHTcEEEEEcccGGGcTTcTTc:Sec Str :============================================================:RP:SCP|382->591|1ay0A2|7e-14|15.1|192/197|c.36.1.6 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|402->578|PF03894|1e-78|74.0|177/179|XFP 541: + . . . . *: 600 :QDPGFIDHVVNKKPEIIRVYLPPDCNTLLCTMDHCLRSRNFINVVIAGKQPQLTYLPMEA:Sequence :ccccHHHHHHHTcccccEEEccccHHHHHHHHHHHHHcccccEEEEccccEcEcccTTcc:Sec Str :=================================================== :RP:SCP|382->591|1ay0A2|7e-14|15.1|192/197|c.36.1.6 :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|402->578|PF03894|1e-78|74.0|177/179|XFP : $$$$$$$$$$$$:RP:PFM|589->790|PF09363|4e-87|70.8|202/203|XFP_C 601: . . . . + .: 660 :AIAHCTRGAGIWEWASSDEGAEPDVVLACAGDVPTLETLAAADLLRRHLPELRVRVVNVV:Sequence :HHHHTTccEEEEcccccccEccccEEEEEcTTHHHHHHHHHHHHHHHTTcTccEEEEEcc:Sec Str :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|589->790|PF09363|4e-87|70.8|202/203|XFP_C 661: . . . * . .: 720 :DLMRLSNEGEHPHAMTDREYDTLFTRDKPVIFAFHGYPWLIHRLTYRRAGHPNLHVRGYK:Sequence :cHHHHHTccHHHHHHHccTTccEEEEcccccGGGGGTcTTGGGTccEEEEcEEEcccccc:Sec Str :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|589->790|PF09363|4e-87|70.8|202/203|XFP_C 721: . . + . . .: 780 :EEGTTTTPFDMVMLNDLDRFHLVMDVIDRVPGLGVRAAGLRQHMQDERLRCRAYTRQYGE:Sequence :cccccccHHHHHHHHTccHHHHHHHHHHHHHHHT TcccccTTcc :Sec Str :============================================================:BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|589->790|PF09363|4e-87|70.8|202/203|XFP_C 781: . * . . . .: 840 :DAPDIRNWVWEP :Sequence : :Sec Str :============ :BL:SWS|2->792|PHK_MYCA1|0.0|68.5|790/804 :$$$$$$$$$$ :RP:PFM|589->790|PF09363|4e-87|70.8|202/203|XFP_C