[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35126.1"

            "transcriptional regulator, XylR-related"
            ""

OrgPattern -------------------------------------------------------------111---- 111-41-----1-------------1-----------1-1-----11-2--12221-1-----211132122111244------1--------2-------------1-1--------------1------------1122---3----------------------11---------------1---54-2-122222222-22223215332-222211141-45545426-22111111122211--1--124----1--2----21111---122-------1--21123422122--11---------211---211-12-16-------3-32211-1111-21-112--------5-11644112--------------------------1111111-111----------1--7121331454-1--------1--1-----------1-----------------------------------------------1----1----------------------------------------------------------------------------------------11--------------------------1--11------------------------------1----------122211-1111111111-111111111111111111122211111111111111111111121111111--111111111111----------------------11--------1---------------------------------------22213333311222------------------------11-111-1--1----1-----1--------------124--45465--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MHKKLNPKSMKRENKKMVLRYLIESGPHSRVEIARKTGLAQSAIWRIIEELVNEGLVEEK:Sequence :HHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHTTcEEEc:Sec Str : ===================================================:RP:SCP|10->68|1z05A1|2e-08|27.1|59/71|a.4.5.63 : =======================================================:BL:SWS|6->350|XYLR_ANATD|1e-19|26.7|329/399 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|18->67|PF01047|1e-04|34.0|50/59|MarR 61: . . . * . .: 120 :GTATGRRRKAVTYGPTRSFITSIIYNVEVLETLVAVGFLDGAWRIIERFSTPKDFDEFKQ:Sequence :cccEEEccTTEEEcccccccEEEEEEEcccEEEEEEEETTccEEEEEEEEcccccccHHH:Sec Str :======== :RP:SCP|10->68|1z05A1|2e-08|27.1|59/71|a.4.5.63 : =====================================:RP:SCP|84->197|2gupA1|6e-13|21.7|106/114|c.55.1.10 :============================================================:BL:SWS|6->350|XYLR_ANATD|1e-19|26.7|329/399 :$$$$$$$ :RP:PFM|18->67|PF01047|1e-04|34.0|50/59|MarR : $$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->243|PF00480|6e-19|37.3|142/181|ROK 121: . . + . . .: 180 :RVTSSYENILKSHVLNKNISKVVFSLPGIVNTESKFLIHAPNLGWRNIDFRREFGNLDLE:Sequence :HHHHHHHHHHHTTTTccEEEEEEEEEccEEETTTTEEEEccccccccccTTTHHHHTccc:Sec Str :============================================================:RP:SCP|84->197|2gupA1|6e-13|21.7|106/114|c.55.1.10 :============================================================:BL:SWS|6->350|XYLR_ANATD|1e-19|26.7|329/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->243|PF00480|6e-19|37.3|142/181|ROK 181: . * . . . .: 240 :VLVENDSNLSLLAEEFFSQDVKESDVAFFLYFGEGIGGAISVNGKIVRGENFAAGEIGHV:Sequence :EEEEEHHHHHHHHHHHccTTHTTcccEEEEEEcccEEEEEEETTEEccccccccccGGGc:Sec Str :================= :RP:SCP|84->197|2gupA1|6e-13|21.7|106/114|c.55.1.10 : ================================:RP:SCP|209->381|2hoeA2|9e-27|34.0|156/168|c.55.1.10 :============================================================:BL:SWS|6->350|XYLR_ANATD|1e-19|26.7|329/399 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|99->243|PF00480|6e-19|37.3|142/181|ROK 241: + . . . . *: 300 :VLDVKNGKEVEEFLSISKLVERMEKFVELQGESLDEKFRYIKRLWFSGEKNVKETMEEFL:Sequence :ccccccccccTTTccHHHHHHHHHTTTTTccccccccHHHHHHHHHHTcHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|209->381|2hoeA2|9e-27|34.0|156/168|c.55.1.10 :============================================================:BL:SWS|6->350|XYLR_ANATD|1e-19|26.7|329/399 :$$$ :RP:PFM|99->243|PF00480|6e-19|37.3|142/181|ROK : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|244->298|PF09840|4e-04|43.8|48/190|DUF2067 301: . . . . + .: 360 :QHVAVVLKNIIYFLNPGVIVLGGVVNDLWDTFGSFIKRELEKITDREIANVLIRDTIFKE:Sequence :HHHHHHHHHHHHHHcccEEEEEcGGGGGHHHHHHHHHHHHHHHccHHHTTccEEEccccT:Sec Str :============================================================:RP:SCP|209->381|2hoeA2|9e-27|34.0|156/168|c.55.1.10 :================================================== :BL:SWS|6->350|XYLR_ANATD|1e-19|26.7|329/399 361: . . . * . .: 420 :ISPSLVGGNVLAIEEFLRQIT :Sequence :HTcGGGGHHHHHHHHHHHHcc :Sec Str :===================== :RP:SCP|209->381|2hoeA2|9e-27|34.0|156/168|c.55.1.10