[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35173.1"

            "iron(III) ABC transporter, permease protein"
            ""

OrgPattern --2-1-1111111111-1-1-112233313211--321212131164854C81-2222342111---- ----246499B6651-1----1---3----------3A46-2132321232-7311132212-68642694--------1221-----22111222---1-11111122----------------13122111223133111137-5-2222-11--------32-1451-------------2321122-168DDEDECDD7EDEEEDA9AABAEEE577C754444444HG499898988999999655664-1----1---33-1--2-----1114442222111222222222222222222222222222111222223B4699998995B6252227564511-521-2CA2--312223222-5141----122112211--1345443433333333337-21-11122322-6777453565743112-23A1-1122-22222222-331--41-------------------------------1--21222222222423333111-333323311-112--111-2---3-3--111111-141--1------1-11-66222123-3111----1---2411--11341253-22222----------211--22464231112211233121221131233322---1121------G4772965779588853-6563779375697555553AABAB7755355555555555555833744453-466666656666--2-----------185D333364--1111--51122111-33213423232522322-466---------15565445449693311---------------111------------5-1-------------------------1121122222--1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKLVFPILILSFLLGIFFGSVPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVG:Sequence : GGGTHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|8->21|ililsfllgiffgs : ================:RP:SCP|45->321|1l7vA|1e-56|31.2|272/324|f.22.1.1 : =================================:BL:SWS|28->318|Y087_METJA|1e-38|32.9|289/349 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->320|PF01032|4e-48|41.6|296/313|FecCD 61: . . . * . .: 120 :AGLSIVGNSFQNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFS:Sequence :HHHHHHHHHHHHHTTcTTccTTTTcHHHHHHHHHHHHHHTTTTccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|45->321|1l7vA|1e-56|31.2|272/324|f.22.1.1 :============================================================:BL:SWS|28->318|Y087_METJA|1e-38|32.9|289/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->320|PF01032|4e-48|41.6|296/313|FecCD 121: . . + . . .: 180 :MIASLLTLLIARKEGRFPVTTIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFS:Sequence :HHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHcccTHTTTHHHHHHHHTTcccT:Sec Str :============================================================:RP:SCP|45->321|1l7vA|1e-56|31.2|272/324|f.22.1.1 :============================================================:BL:SWS|28->318|Y087_METJA|1e-38|32.9|289/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->320|PF01032|4e-48|41.6|296/313|FecCD 181: . * . . . .: 240 :GSTWEDVLFYLMVVIPFLLYSLIFSKHLNAMALGEEEAFILGVSVERLKVVTFLFGNLIT:Sequence :TccHHHHHHHHHHHHHHHHHHHHTTTGGGGGGccHHHHHHTTccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|45->321|1l7vA|1e-56|31.2|272/324|f.22.1.1 :============================================================:BL:SWS|28->318|Y087_METJA|1e-38|32.9|289/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->320|PF01032|4e-48|41.6|296/313|FecCD 241: + . . . . *: 300 :AFLVSRSGVIGFVGLIVPHISRYLVGPNFLKSVLSSLIVGGVLLTLCDTAARTFFSPTEL:Sequence :HHHHHHHccccccTTHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccc:Sec Str : XXXXXXXXXXXXXXXXX :SEG|270->286|lksvlsslivggvlltl :============================================================:RP:SCP|45->321|1l7vA|1e-56|31.2|272/324|f.22.1.1 :============================================================:BL:SWS|28->318|Y087_METJA|1e-38|32.9|289/349 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|22->320|PF01032|4e-48|41.6|296/313|FecCD 301: . . . . + .: 360 :PVGVVTALIGAPFLAFLMKRGV :Sequence :cHHHHHHHHHHHHHHHHH :Sec Str :===================== :RP:SCP|45->321|1l7vA|1e-56|31.2|272/324|f.22.1.1 :================== :BL:SWS|28->318|Y087_METJA|1e-38|32.9|289/349 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|22->320|PF01032|4e-48|41.6|296/313|FecCD