[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD35173.1 tmar0 AAD35173.1 "iron(III) ABC transporter, permease protein"
MRKLVFPILILSFLLGIFFGSVPLDPLEVLGVLFGLKENPGVERILSLRIPRVLASFLVG
AGLSIVGNSFQNLLKNPLVDPYLLGISSGASFGTVVSFYLAETLGISWIYRIPLLSFGFS
MIASLLTLLIARKEGRFPVTTIVLSGVVVSTLFSSLTYMTIVLLKRNVTTISMWLFGSFS
GSTWEDVLFYLMVVIPFLLYSLIFSKHLNAMALGEEEAFILGVSVERLKVVTFLFGNLIT
AFLVSRSGVIGFVGLIVPHISRYLVGPNFLKSVLSSLIVGGVLLTLCDTAARTFFSPTEL
PVGVVTALIGAPFLAFLMKRGV
//