[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35255.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSFLKKLLEIVLKRKILFFTLVFISITVFFLLIFFQKEGSLKIGKEGAESGFINLRVEIP:Sequence : :Sec Str 61: . . . * . .: 120 :PGAFGKQKVLKITRLSDEERKLYPDVFVGDLYRVEFADGVDEFALKPIRLKYYFDAKYLR:Sequence : HHHHHHHHHHHccc:Sec Str 121: . . + . . .: 180 :GENYNNLTFAYATEDGGYRIIPGSMIGKDERGYYVEAFTYHLSVFGVVLRSAGFQKHGIR:Sequence :cccEHHHHHHHHHHTTcccccEEEE EEETTccEEEEEEEcccEEccHHH:Sec Str : ============:RP:SCP|169->328|1c4xA|4e-09|20.4|147/281|c.69.1.10 181: . * . . . .: 240 :LLREAVNSSGPAVLLVPGEDPTFEGVVKDNNIWETIFPDRTIMTYEYALYEPRSLAYSEM:Sequence :HccGGGGcccccEEEEcccTTTTTcHHHcGGGGHHHHHHHHHTTccGGGEEEcccccTTc:Sec Str :============================================================:RP:SCP|169->328|1c4xA|4e-09|20.4|147/281|c.69.1.10 241: + . . . . *: 300 :YRSFIEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGTGGLIVLRMLQRHPEVNNVRK:Sequence :cHHHEEEccTTcHHHHHHHHHHHHHHHHccccEEEEEETHHHHHHHHHHHHcGGGGTEEE:Sec Str :============================================================:RP:SCP|169->328|1c4xA|4e-09|20.4|147/281|c.69.1.10 : =======================================================:BL:SWS|246->392|MAGA6_HUMAN|8e-04|33.9|124/314 301: . . . . + .: 360 :VVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIRNLIDTLGEVV:Sequence :EEEEcccGGGTccccccccccccccEEEEEEETTcccccHHHHcccTcEEEEEccccTGG:Sec Str :============================ :RP:SCP|169->328|1c4xA|4e-09|20.4|147/281|c.69.1.10 :============================================================:BL:SWS|246->392|MAGA6_HUMAN|8e-04|33.9|124/314 361: . . . * . .: 420 :QEILPDSQLVKELGGFSRNDVEIVSICGDTPPYGVDVSGTELERFYPEFVKGRGDGFVSI:Sequence :GGGcHH :Sec Str :================================ :BL:SWS|246->392|MAGA6_HUMAN|8e-04|33.9|124/314 421: . . + . . .: 480 :QSCRVGKVEQLSGNFYDLYSREENVAYIRELLKYEVQVFSGFRSDDYEEYLPSKNPELSE:Sequence : :Sec Str 481: . * . . . .: 540 :ESAQKVVEVKETEGTEFPVLPVNILFENFLERIRSLELSSYLSGALVGKEVYIATESGVF:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|485->496|kvvevketegte : ==============================:RP:SCP|511->752|1inpA|1e-04|10.3|232/400|e.7.1.1 541: + . . . . *: 600 :AWDKKVLDKKIEFFKKIEDYASFVGEGDIFIIDNIGIKKYAPFPLVGDISDALITRNAII:Sequence : :Sec Str :============================================================:RP:SCP|511->752|1inpA|1e-04|10.3|232/400|e.7.1.1 601: . . . . + .: 660 :YARVVPGGVRYYLFRNGAEKLIATSPGTTVRMKSENGNYLLITDGEVVAIGSDFKEKGRV:Sequence : :Sec Str :============================================================:RP:SCP|511->752|1inpA|1e-04|10.3|232/400|e.7.1.1 661: . . . * . .: 720 :LSSLFGEKVKIVDASFKDDAFYILLNDGSIAFVSSSRSETKNYGLAVPKKVLNFQGRILV:Sequence : :Sec Str :============================================================:RP:SCP|511->752|1inpA|1e-04|10.3|232/400|e.7.1.1 721: . . + . . .: 780 :VYDGVILDLSAGKAQRFDRGIIDVFPGNESLFIVFDEKVRVSVEEWWLSKD :Sequence : :Sec Str :================================ :RP:SCP|511->752|1inpA|1e-04|10.3|232/400|e.7.1.1