[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD35255.1 tmar0 AAD35255.1 "hypothetical protein"
MSFLKKLLEIVLKRKILFFTLVFISITVFFLLIFFQKEGSLKIGKEGAESGFINLRVEIP
PGAFGKQKVLKITRLSDEERKLYPDVFVGDLYRVEFADGVDEFALKPIRLKYYFDAKYLR
GENYNNLTFAYATEDGGYRIIPGSMIGKDERGYYVEAFTYHLSVFGVVLRSAGFQKHGIR
LLREAVNSSGPAVLLVPGEDPTFEGVVKDNNIWETIFPDRTIMTYEYALYEPRSLAYSEM
YRSFIEKEGRRSFIDFESDFLSQEILKYSQYEFDILAHGTGGLIVLRMLQRHPEVNNVRK
VVLLSTPVQGTNVVNPLYFSSIFYGKDPEVLEDIFGIEWTKLKMLTLHIRNLIDTLGEVV
QEILPDSQLVKELGGFSRNDVEIVSICGDTPPYGVDVSGTELERFYPEFVKGRGDGFVSI
QSCRVGKVEQLSGNFYDLYSREENVAYIRELLKYEVQVFSGFRSDDYEEYLPSKNPELSE
ESAQKVVEVKETEGTEFPVLPVNILFENFLERIRSLELSSYLSGALVGKEVYIATESGVF
AWDKKVLDKKIEFFKKIEDYASFVGEGDIFIIDNIGIKKYAPFPLVGDISDALITRNAII
YARVVPGGVRYYLFRNGAEKLIATSPGTTVRMKSENGNYLLITDGEVVAIGSDFKEKGRV
LSSLFGEKVKIVDASFKDDAFYILLNDGSIAFVSSSRSETKNYGLAVPKKVLNFQGRILV
VYDGVILDLSAGKAQRFDRGIIDVFPGNESLFIVFDEKVRVSVEEWWLSKD
//