[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35418.1"

            "orotate phosphoribosyltransferase"
PYRE_THEMA  "RecName: Full=Orotate phosphoribosyltransferase;         Short=OPRT;         Short=OPRTase;         EC=2.4.2.10;"

OrgPattern --11--1-1111111111-1---2--------1-111------------1311-1111111-1-1--- --2-----111---1--------------------------------------------------------------------1-111-------------------------------------11111111111111--111-1111---111-----1--11--1112------------11111112------------------------------------------------------------------------------------------------------------------------------------111--1111111-1--1111111-1-111--1-111111111111111--1-1111111111--1----------11111111111-1111111--11---------------111--------------------------1111111111---------------1111111111-------------------------------------------------------------------------1---1-1--1111-----1--------11-111111111111111111111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1-1111111111- --------211----------------------------------------------------------------------------------------------------------------------------------------------------13-----------1-------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIKEILEKTGALMEGHFILSSGKHSSRYVQCARLFEFPEYGDVVGEELAKLLKKYDVETV:Sequence :cccHHHHHHTcEEEcTTcTcccccccEEEcGGGGGGcHHHHHHHHHHHHHHHHHHTccEE:Sec Str : =======================================================:RP:SCP|6->176|2aeeA1|2e-17|20.1|169/204|c.61.1.1 :============================================================:BL:SWS|1->187|PYRE_THEMA|e-105|100.0|187/187 : $$$$$:RP:PFM|56->136|PF00156|7e-06|43.2|81/116|Pribosyltran 61: . . . * . .: 120 :VGPAMGGVILSYVVARYLKARSLFAERENGVMKLRRGFFVKPGEKVAVVEDVVTTGGSVK:Sequence :EEETTTTHHHHHHHHHHTTccEEEEcccccccEEcEEccccTTcEEEEEEEEEcccHHHH:Sec Str :============================================================:RP:SCP|6->176|2aeeA1|2e-17|20.1|169/204|c.61.1.1 :============================================================:BL:SWS|1->187|PYRE_THEMA|e-105|100.0|187/187 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|56->136|PF00156|7e-06|43.2|81/116|Pribosyltran 121: . . + . . .: 180 :EVIELLKEYGANVVCVGSIIDRSGGKVDFGVPFESLLKLDLPVYDPEDCPLCKQGIPAEK:Sequence :HHHHHHHHTTcEEEEEEEEEEcccHHHHHTccEEEcccHHGGccccccccccccHH :Sec Str :======================================================== :RP:SCP|6->176|2aeeA1|2e-17|20.1|169/204|c.61.1.1 :============================================================:BL:SWS|1->187|PYRE_THEMA|e-105|100.0|187/187 :$$$$$$$$$$$$$$$$ :RP:PFM|56->136|PF00156|7e-06|43.2|81/116|Pribosyltran 181: . * . . . .: 240 :PGSRGLK :Sequence : :Sec Str :======= :BL:SWS|1->187|PYRE_THEMA|e-105|100.0|187/187