[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35545.1"

            "oligopeptide ABC transporter, periplasmic oligo-peptide binding protein, putative"
            ""

OrgPattern 331-2121211111-11-1221-1----1-2--------------1-1--531-1121--1--13--- ---------------------1---4------2222-------112-1--------1---221-112-11------------11111-------------------1------------------1-------12-211--1113611--1--21----------1-1--1------------52411221-112222232412224236433314221-34511-11111J4--------------------21-------1--------1-----------111--------------------------------1----131--2221231122--2211111111-5-1-122141-141-215114-111----1411521466---2-11-23333332339---2--22255--BCC6442653892-----342223154------------1-33------------------------------------44424444443222232352322-23432212--112-1243125134-1-----1-----------1--112-11241132221111111111------11-----------1-1111111-------341-1211-1111111---111---11-11---1---------44552735554544435-5554544454545455554545641133323333333333333433444441-111111111111---1-----------3134441111121-3--3--------11115555232543223-5861-11-1----22232222231111-----------------3------1-----------------------------------222212822211- -------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKLFVLFLAVLSVLVLAEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIA:Sequence : ccccccEEEEEEEcccccccccccHHHHHHTGGGTTTTcccE:Sec Str : XXXXXXXXXXXXXXX :SEG|4->18|lfvlflavlsvlvla : ==========================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 : ====================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 61: . . . * . .: 120 :YKGESLTEFEPRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPT:Sequence :EcTcTTccEEccccEEEEEETTTTEEEEEEcTTcccTTcccccHHHHHHHHHHHHcGGGc:Sec Str : ####################### :PROS|74->96|PS01040|SBP_BACTERIAL_5|PDOC00799| :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 121: . . + . . .: 180 :AGPMWMLWEALFGVDSLETFVEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIE:Sequence :cccccTTGGGcTTHHHHHHTHcTTccccccTTEEccccccHccHHHHTTcTTccEEEEEE:Sec Str :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 181: . * . . . .: 240 :VEGDAVVFHLVRPFAPFMYILAQSASWSAVLDKEWCIEIGCWDGRADTWWKYHDIRKEDS:Sequence :EETTEEEEEcccccGGGGcTTccGcccccccccHHHHTTccGGGTTTcTTcHHHHTTcTT:Sec Str :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 241: + . . . . *: 300 :PLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIKRVIIWGIDEWSTRRAMFLQG:Sequence :HTTTcccccccEEEEEEETTTTEEEEEEcTTcccccccccEEEEEEEcGGGHHHHHHTTc:Sec Str :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 301: . . . . + .: 360 :DADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGSGKLDGNGIPP:Sequence :ccEEEcccGGGHHHHTTcTTEEEEEETEccEEEEEEEcccEEETTTTEEEcccccccccG:Sec Str :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 361: . . . * . .: 420 :DFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDLPEGLLGFNEELLNDPDAPHFDIV:Sequence :TGGGcHHHHHHHHHHccHHHHHHHHcTTcEEEEEccccccTTcGGGccTTccccccccHH:Sec Str : XXXXXXXXXXXXXX :SEG|397->410|lpegllgfneelln :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 421: . . + . . .: 480 :KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWP:Sequence :HHHHHHHTTccEEETTEEcEEEEEcccccTTHHHHHHHHHHHHHHTTEEcEEEEGGGccc:Sec Str : ########## :PROS|443->452|PS00659|GLYCOSYL_HYDROL_F5|PDOC00565| :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 481: . * . . . .: 540 :TYLDATKRGEVPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGG:Sequence :cHHHHHHHHHcccccccccEEEEEEEcccccccHHHHcTHHHTcTTcTTccccHHcccH :Sec Str :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|71->517|PF00496|5e-36|35.4|359/366|SBP_bac_5 541: + . . . . *: 600 :RSLDELIEEAIAKTDPAERQALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPM:Sequence : HHHHHHHHHTccGcHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEETTEEcEEccTT:Sec Str :============================================================:RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1 :============================================================:BL:SWS|25->600|DPPA_ECOLI|2e-30|30.1|482/535 601: . . . . + .: 660 :RPGDDYYVLWKAEE :Sequence :cccHHHHcEEcccc :Sec Str :============= :RP:SCP|19->613|1xocA1|1e-73|21.4|496/504|c.94.1.1