[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD35545.1 tmar0 AAD35545.1 "oligopeptide ABC transporter, periplasmic oligo-peptide binding protein, putative"
MKKLFVLFLAVLSVLVLAEVKNPDTIIDATIGEPDTLDPHFAYDTASGEVIYNVYENLIA
YKGESLTEFEPRLAERWEILDDGKTYKFYIRKGVKFHEGGDLTPEDVEYSFERGLIFDPT
AGPMWMLWEALFGVDSLETFVEEKIGKPYSELFDENGEPLPEYRDALIKIYTDYIDPAIE
VEGDAVVFHLVRPFAPFMYILAQSASWSAVLDKEWCIEIGCWDGRADTWWKYHDIRKEDS
PLYARMNGTGPFKFVEWDRAQQKVILERNDNYWREPAKIKRVIIWGIDEWSTRRAMFLQG
DADICAVPTQYLEQVEGKPGVTVVKGLPELAVTSLHFAWNVPEDSKYIGSGKLDGNGIPP
DFFSDENVRKAFIYAFDYDTFINEVLKGLGRKIPTDLPEGLLGFNEELLNDPDAPHFDIV
KATEYFKKAWNGEVWKKGFKITLLYNTGNEVRRQAAEMLKAYIEMINPKFKVEVRGVQWP
TYLDATKRGEVPAFIIGWLADYPDPHNFIFTYYHSAGVYSGRQGENFRKFVSTPHPDLGG
RSLDELIEEAIAKTDPAERQALYEEIQRFAMKHALGMPLYQPLGVRVQRSWVKGWYHNPM
RPGDDYYVLWKAEE
//