[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35671.1"

            "conserved hypothetical protein"
            ""

OrgPattern ------------------1----2--------------11121------1-----11----------- ------------------------------------------------------------------------------------1---1111-1-------------------------------------------------1--------------------------------------------111---1111143221224531-22-32111--2--1-----121-----------------------------------------------------------------------------------------1-1--2-------1-11-11----1-------1-11-2--1-1-------------------1-------11-111------------------------------------11----------------------------------------------------------1-------------------------------1--1111-------1---1------1-----1--------------11-4--121211--1-11------------1------------------------------------11-1------1--------------1---------------------------------------------111-11---------------------------------------------------------1----1--1------1---1------1--------1---------1---------1------------------------------1------------------------------------------22-1121222--1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------9---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MILERFFAWLVVVFWGISFLATKVVVQVLDPFFAGFLRFIFAFFFLFLISGGRPKLFNKN:Sequence : XXXXXXXXXXXXXXXXXX :SEG|32->49|ffagflrfifaffflfli : =====================================================:BL:SWS|8->246|YBFH_BACSU|2e-25|29.7|236/306 61: . . . * . .: 120 :IVMAGFWGVFSYFAFENSALMFTEPTNAAIIVSSAPVFFLLFSHLVQKKKTTSKMYLGVI:Sequence :============================================================:RP:SCP|61->133|1s7bA|8e-08|16.4|73/106|f.39.1.1 :============================================================:BL:SWS|8->246|YBFH_BACSU|2e-25|29.7|236/306 121: . . + . . .: 180 :LSFLGVALVVLNGRFVLKLNPLGDLLAFGAALSWVFYTHHIESLGSLSFRENAGIMFWGV:Sequence :============= :RP:SCP|61->133|1s7bA|8e-08|16.4|73/106|f.39.1.1 :============================================================:BL:SWS|8->246|YBFH_BACSU|2e-25|29.7|236/306 181: . * . . . .: 240 :VFFLPFSAGKFQQIREMNSIVVISLLYLGLVCSGLAYFLWNKAIERLGSRTTTNMIYYIP:Sequence :============================================================:BL:SWS|8->246|YBFH_BACSU|2e-25|29.7|236/306 241: + . . . . *: 300 :VVTAVAEHLLKLKLPSALLVGGVVLVVIGLLIFEREVHYETEDSTRGMRKDRTEETRPSA:Sequence : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|249->272|llklklpsallvggvvlvviglli :====== :BL:SWS|8->246|YBFH_BACSU|2e-25|29.7|236/306 301: . . . . + .: 360 :D :Sequence