[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD35671.1 tmar0 AAD35671.1 "conserved hypothetical protein"
MILERFFAWLVVVFWGISFLATKVVVQVLDPFFAGFLRFIFAFFFLFLISGGRPKLFNKN
IVMAGFWGVFSYFAFENSALMFTEPTNAAIIVSSAPVFFLLFSHLVQKKKTTSKMYLGVI
LSFLGVALVVLNGRFVLKLNPLGDLLAFGAALSWVFYTHHIESLGSLSFRENAGIMFWGV
VFFLPFSAGKFQQIREMNSIVVISLLYLGLVCSGLAYFLWNKAIERLGSRTTTNMIYYIP
VVTAVAEHLLKLKLPSALLVGGVVLVVIGLLIFEREVHYETEDSTRGMRKDRTEETRPSA
D
//