[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35678.1"

            "amino acid ABC transporter, periplasmic amino acid-binding protein"
            ""

OrgPattern 11---1----------1-2222212--11-1111----7599312114-11-1----1------1--- ----432322224232211-18112D111111A88836CC14334142322-656223--112-7666492644454421321-----221--1----------1----111111111111111-1---1-16-1-222441113-34585563233-1-11-14114461--11----11--4441133--263444447544554453332674453225544444443A42222222222222222222256479887556666688364684222555655537766677776667555445555555539898888872455B44355552324433233323221333317715121-2111122281--11114322333K79332422325665537767N-11C11A1B7E21UMMIIGHMJMGJH8---13A54562451111111132311225----------111111111111111--1-2-----7CAACOQQRRPA9AA9JJKTBBBB8BQIX7CA7--CCD44954F6DAHG126--11853322222---14-17D2777B4BC99946168-521132-31--516447444443222222222132----776-3121--912111123111142341522-5-1-1------99HG8BA7887886888-889888878888878777AHLFHG663C8798A9999A99998E777978741A89999998999--3-111116666--47B33363522222222144444-53652-EEDFCMJR9AC993DDD---------1454955555666551-1-1-----------47111122--------2131-2----------------------131-124212-11 --------------------------------------------------------1-----------------------------------------------------------------------------------------------------1----1------1--1-----------1--11--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKLLAVSILLVSIVIFSGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKE:Sequence : cEEcccTTcEEEEEEEccccTTTcEEcTTccEEcHHHHHHHH:Sec Str : XXXXXXXXXXXXXXX :SEG|4->18|llavsillvsivifs : ===============================:RP:SCP|30->246|1ii5A|3e-51|25.1|211/222|c.94.1.1 : ===============================:BL:SWS|30->245|ARTP_BACSU|5e-37|41.5|212/255 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->244|PF00497|8e-43|46.0|213/222|SBP_bac_3 61: . . . * . .: 120 :IARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVV:Sequence :HHHHHTcEEEEEEccGGGHHHHHHTTcccEEcccccccHHHHTTEEEEEEEEEEEcEEEE:Sec Str :============================================================:RP:SCP|30->246|1ii5A|3e-51|25.1|211/222|c.94.1.1 :============================================================:BL:SWS|30->245|ARTP_BACSU|5e-37|41.5|212/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->244|PF00497|8e-43|46.0|213/222|SBP_bac_3 121: . . + . . .: 180 :RKDSDFRPKTYEDLVGKTVAVQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAV:Sequence :EEEcccccccccGGGcccEEEETTcHHHHHHHHcTTccEEEEccHHHHHHHHHTTcccEE:Sec Str :============================================================:RP:SCP|30->246|1ii5A|3e-51|25.1|211/222|c.94.1.1 :============================================================:BL:SWS|30->245|ARTP_BACSU|5e-37|41.5|212/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->244|PF00497|8e-43|46.0|213/222|SBP_bac_3 181: . * . . . .: 240 :VLDSATARAFVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELKKSPYDVLI:Sequence :EEcHHHHHHHGGGcTTEEEccGGGcEEEEEEEEETTcHHHHHHHHHHHHHHHHTTHHHHH:Sec Str :============================================================:RP:SCP|30->246|1ii5A|3e-51|25.1|211/222|c.94.1.1 :============================================================:BL:SWS|30->245|ARTP_BACSU|5e-37|41.5|212/255 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|31->244|PF00497|8e-43|46.0|213/222|SBP_bac_3 241: + . . . . *: 300 :EKWFSE :Sequence :HHTTcc :Sec Str :====== :RP:SCP|30->246|1ii5A|3e-51|25.1|211/222|c.94.1.1 :===== :BL:SWS|30->245|ARTP_BACSU|5e-37|41.5|212/255 :$$$$ :RP:PFM|31->244|PF00497|8e-43|46.0|213/222|SBP_bac_3