[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD35678.1 tmar0 AAD35678.1 "amino acid ABC transporter, periplasmic amino acid-binding protein"
MKKLLAVSILLVSIVIFSGAIDEIKSRGYLLVGLSADFPPFEFVDENGNIVGFDVDLAKE
IARRLGVELKIVDMTFDGLIPSLLTKKIDVIISGMTITEERKKVVAFSDPYFDAGQVIVV
RKDSDFRPKTYEDLVGKTVAVQIGTTGDIEVSKYDGIKVVRFDKFTDAFLELKRGRADAV
VLDSATARAFVAKNPDLVISSGVLSSEQYGIAVRKEDTDLLEFINSVLRELKKSPYDVLI
EKWFSE
//