[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35750.1"

            "pleiotropic regulatory protein"
            ""

OrgPattern -----1--1-------1311111----2-1--222-1211--112-1414-11111-1-12---1-12 266-5---11----1--12-2---2-21222-----22112334-41-----223-----52316351-5---------231-113419433-711---43445334717--------------23233222344145575---2-4431444122222121214213364422222224122---1-222--411212221-212141--444312312-1211------22---------------2--1-------------1-----1-----------------11111111111-----------------------111353334444533--33311--3412-121332334311-1--21---221433311111115424322112322222222221-11221415321-----3425353133222222-1222421111111121112A12-----------------------------23-11-333233223222222211234444242243233124326223-13132212411215311111111-21213325424435665448449538531222-35355531443453131111111441342241-112223113223251222222332143---2212------23232322332222322-32222222323223323322225876232333333332333322211222321233333323333--1-444442222311-31112-21----2--1-1111111311-212125521--222322211111111342111111112-131123333223------73667779--------211-------------------------2233322222241 -------------1--------1212-------111--------------1---------------------------------------------------------2------------------------------------------------------2---------11---3F--2-----1---2-1---3 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGS:Sequence :cccccccccccccHHHcHHHHHHHHHHHccccccHHHHHHHHHHHHHHTccEEEEEccHH:Sec Str : =============================================:RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 : ===========================================================:BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1 61: . . . * . .: 120 :DALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVL:Sequence :HHHHHHHHHTTccTTcEEEEEccccTHHHHHHHHHTcEEEEEcccTTTccccHHHHGGGc:Sec Str :============================================================:RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 :============================================================:BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1 121: . . + . . .: 180 :KKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVG:Sequence :ccTTEEEEccccGGGccccHHHHHHHHHHTTcEEEEEcTTcTTcEETTcETcTEETTccc:Sec Str :============================================================:RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 :============================================================:BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1 181: . * . . . .: 240 :DAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIH:Sequence :cEEEEEccTcTTcccccccEEEEEccHHHHHHHHHHHcTTccTTTccccccccccccHHH:Sec Str :============================================================:RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 :============================================================:BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1 241: + . . . . *: 300 :AAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYVVLFEN:Sequence :HHHHHHHHHTHHHHHHHHHHHHHHHHHHGGGGGGGEEcccccTTcccccccEEEEEcTTc:Sec Str : XXXXXX:SEG|295->314|vvlfeneevrervreglker :============================================================:RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 :============================================================:BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1 301: . . . . + .: 360 :EEVRERVREGLKERGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPE:Sequence :cccHHHHHHHHHHTTcccEEcccccGGGcGGGGGGccccTTcHHHHHHHHHEEEEcccTT:Sec Str :XXXXXXXXXXXXXX :SEG|295->314|vvlfeneevrervreglker :============================================================:RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 :============================================================:BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1 361: . . . * . .: 420 :LRDDEIKEVVDTIALFL :Sequence :ccHHHHHHHHHHHHHHc :Sec Str :============= :RP:SCP|16->373|1o61A|1e-86|24.4|348/374|c.67.1.4 :================ :BL:SWS|2->376|DEGT_BACST|9e-94|46.8|365/372 :$$$$$$$$$$$$$ :RP:PFM|17->373|PF01041|6e-74|41.7|348/358|DegT_DnrJ_EryC1