[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD35750.1 tmar0 AAD35750.1 "pleiotropic regulatory protein"
MIPLFDLTRQYERIRGEILNAIDKLISSGNVILGENVRRLEEEIASFTGVKHGVGVASGS
DALLIALRAMGVEKGDTVVTTPYTFFATASAPYRLGARVIFVDVDESTFNMDLNQLEHVL
KKEKVKAIIPVHLFGRTVDLEALSFLREKYGVMILEDCAQSMGSEWKFSSGEIRKSGSVG
DAAIFSFFPTKNLGTYGDGGMIVTNSDEIAEESRILRVHGARKKYFHEKVGYNSRLDEIH
AAILRVKLRYLERWTEERTRVARTYQKLFEEKKLPVVYPRVEEKGFRYHVFHQYVVLFEN
EEVRERVREGLKERGIQTAIYYPLPLHLQKCFRDLGYQEGDFPVAESLSKRSLALPMFPE
LRDDEIKEVVDTIALFL
//