[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD35944.1"

            "glucose-1-phosphate thymidylyltransferase"
            ""

OrgPattern 43325287899889974433455276655646345223232325445767656265554453231122 3134333444443332222-2533222222233333245344431121-2224431111152-1233635311111114123534244543312111--31322133332--------------134333533436788783345353332354344322132343A4434223333223224343113222455656666567655664844476673551644222322593222222222222213222334233533333442264242332444444466644434434434434444444443444344433344444517633344454365466766512623522345576424432344323412-222211111212434322222111111111112-33343333342233332423354422323232323322-3333333333312521-----------------------------1123113111-54545635545336666665455843423323323122223322443244443334444333434352335241232322253454444322224132222113322321111111114211422442222244125445335554335365366--23333------22222443222332343-23322222322423333335232234332232322222323324333333231333333333343--212222222213442221131131111111122222333313322224253433333223322221222383221111125214333333323333331152334444-11-----1-3--------11--1---2211-----2243442343221 1111211-311-232121121222222112222222222222222222212222122112222111111122121111111-111-11----2---111113-2141142221222-111111121121342-111-1--11111-1---2--1131122222321-21352231211--1--112365-32--2111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKAIVLCAGKGTRLRPLTFTTAKHLIPIANKPILFYSLENIARAGIEEVGIVVSPHNAE:Sequence :ccEEEEEcccccGGGTTGGGcccGGGcEETTEEHHHHHHHHHHHTTccEEEEEEEcGGGH:Sec Str : ===========================================================:RP:SCP|2->235|1fxoA|1e-66|37.2|234/292|c.68.1.6 : ==========================================================:BL:SWS|3->355|STRD_STRGR|2e-87|46.2|351/355 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->217|PF00483|1e-42|42.1|214/238|NTP_transferase 61: . . . * . .: 120 :EFKSIVGTGENFGLRISYIIQEEPKGLAHAVWVSREFLGDEDFMMYLGDNLILEDLGKFV:Sequence :HHHHHHcccHHHTcEEEEEEcTTcccHHHHHHTTHHHHccccEEEEcTTEEEcTTHHHHH:Sec Str :============================================================:RP:SCP|2->235|1fxoA|1e-66|37.2|234/292|c.68.1.6 :============================================================:BL:SWS|3->355|STRD_STRGR|2e-87|46.2|351/355 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->217|PF00483|1e-42|42.1|214/238|NTP_transferase 121: . . + . . .: 180 :KDFENSDYAASILLSPVKDPTRFGVAVMEGDRVIKVVEKPKTPPSNLAIVGLYLFRNKIF:Sequence :HHHHHHccEEEEEEEEcccGGGcccEEcTTcEEcEEccccTTccccEEEEEEEEEcTTHH:Sec Str :============================================================:RP:SCP|2->235|1fxoA|1e-66|37.2|234/292|c.68.1.6 :============================================================:BL:SWS|3->355|STRD_STRGR|2e-87|46.2|351/355 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->217|PF00483|1e-42|42.1|214/238|NTP_transferase 181: . * . . . .: 240 :EGIKNIKPSWRGELEITDAIEYLIEKGEKVRGYIVYGWWKDTGKPEDLLEANRKILMETT:Sequence :HHHHHccccGGGcccHHHHHHHHHHHcccEEEEEccccEEETTcHHHHHHHHHHHHHHHH:Sec Str : XXXXX:SEG|236->247|lmetteellgem :======================================================= :RP:SCP|2->235|1fxoA|1e-66|37.2|234/292|c.68.1.6 :============================================================:BL:SWS|3->355|STRD_STRGR|2e-87|46.2|351/355 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->217|PF00483|1e-42|42.1|214/238|NTP_transferase 241: + . . . . *: 300 :EELLGEMDDKSSIQGPVRIGKASKIVNSVIRGPAVIGENCFIKNSYVGPYSSIGNRVILE:Sequence :HTTcEEccGGGEEccccEEcTTcEEccEEEETTcEEccccEEcccEEccccEEEEEEEcT:Sec Str :XXXXXXX :SEG|236->247|lmetteellgem : ==================================:RP:SCP|267->333|1fwyA1|1e-06|24.2|66/77|b.81.1.4 :============================================================:BL:SWS|3->355|STRD_STRGR|2e-87|46.2|351/355 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|251->310|PF07959|1e-04|28.3|60/394|Fucokinase 301: . . . . + .: 360 :DCEVENSIVMDECSITGVEKRIDSSILGKGVSVKGSQKRPASLNLILGNMSRVEL :Sequence :TcEEccEEEEETcEEcccEEEcTTEEEcTTcEEEEEEEEccEETcEEEEEEEEE :Sec Str :================================= :RP:SCP|267->333|1fwyA1|1e-06|24.2|66/77|b.81.1.4 :======================================================= :BL:SWS|3->355|STRD_STRGR|2e-87|46.2|351/355 :$$$$$$$$$$ :RP:PFM|251->310|PF07959|1e-04|28.3|60/394|Fucokinase