[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36098.1"

            "permease, putative"
            ""

OrgPattern --1-2-633222334331111--2------1---21-122121131-331122--2312136321--- 268-4-22665333-1--------22-----111-124A7-11-1222222-2111-1--1141215553-11112----115-1-1144-1-1------13--151428--------------1--1---211--4222211131-11-11---11------12------------------232----374999999ACC7BDABBC43DD5ACBA3458442234343F91223233321222226333442324421212663344514332343---1----1111111111111-------------------1------55---------112331111--1--2--2-FC333-1422---1------C44C-----215221-113---22232233324-11311946-44-7443651A84117343111111111--555555552--2-121----------112-22-2111-11----1-25H2-1---36BC7B77333377FD333215D2H6HB2-1655--31181313324--11-12--1-1-1---1-2512-22-1--1112232211-41112-15-111-1-1-1-1-1-1-------1----3322-2-2--43-21111-231111113214--------------54332636555655566-5656755656566666667575332647476769987757566944355651-655554455454--1-11-112333---2-----12-1111--11BB89B272316-555535943B9F737751133342212324333333131441211111111-------1331121------------------------------------11-1111111-11 1111332-2-----1-A5197CAEDID6655356544444134343776BB8886853415341--3521251-547345122-1221-975A3433237---822-3524B85A65221-14275-A5CS71769-2--6-376252--6-1512356345343A1A76E65471222Q322444489297432-111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MAVIFILILMVLLNADQMVMSPNIGAIEQEFNITDAQIGLVASSFTVIGALVSLVWGYLA:Sequence : HHHHHHHHHHHHTTcccTTHHHHHHHHHHHHHHHHHHTTGcTTc:Sec Str : ================================:RP:SCP|29->227|1pv6A|3e-15|18.0|194/417|f.38.1.2 :============================================================:BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->179|PF07690|7e-19|31.1|164/347|MFS_1 61: . . . * . .: 120 :DRYSRKNLLIYSILVGEIPCLMSAFSRSYGELFFWRALTGIGVGASFPIVYSMIGDMFDE:Sequence :ccccTTccccccHHHHHHHHHHHHHcccHHHHTTccEETTEEccccccccccGGGccccE:Sec Str :============================================================:RP:SCP|29->227|1pv6A|3e-15|18.0|194/417|f.38.1.2 :============================================================:BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|16->179|PF07690|7e-19|31.1|164/347|MFS_1 121: . . + . . .: 180 :VKRGKVVALISSAISIGSVLGMIVGGFLGPKYGWRVPFIAVSVPNIFFAVLSIFVLKEPK:Sequence :EEEccccTTccHHHHHHHHcccEEEEEEEccTTcTTcccHHHHHHHHHHHHHHHHcccc :Sec Str :============================================================:RP:SCP|29->227|1pv6A|3e-15|18.0|194/417|f.38.1.2 :============================================================:BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|16->179|PF07690|7e-19|31.1|164/347|MFS_1 181: . * . . . .: 240 :RGAFEKGIGELVQSGYEYPKAPKLSDYAKLVKVKTNLLLFFQGIAGTIPWGAIPYFLVEF:Sequence : HHHHHHHHHHHT ccccHHHH :Sec Str :=============================================== :RP:SCP|29->227|1pv6A|3e-15|18.0|194/417|f.38.1.2 :============================================================:BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 241: + . . . . *: 300 :FRRERGLSVETATLVFLVFGLGNIVGIILGGLWGASIYAKSRPFLPLFCSITTALGTFFT:Sequence : :Sec Str : XXXXXXXXXXXXXXX :SEG|260->274|glgnivgiilgglwg :============================================================:BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 301: . . . . + .: 360 :VMTLDYMGSLLVLMLLGFIASFTASLTGPNVKFMLLNVNEPQERGRIFSIFNLTDSLGTG:Sequence : :Sec Str :============================================================:BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 : $$$$$$$$$$$:RP:PFM|350->398|PF10136|8e-04|42.9|49/644|SpecificRecomb 361: . . . * . .: 420 :FGKFAGGVMSVALGSLGAALKVSAYFWLICAVLLFVLVFYFAKDVERLQKTMIELAKNSQ:Sequence : :Sec Str :================================================= :BL:SWS|1->409|SPNS1_XENTR|3e-19|28.5|403/526 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|350->398|PF10136|8e-04|42.9|49/644|SpecificRecomb 421: . . + . . .: 480 :TR :Sequence : :Sec Str