[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36283.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMLIAAFFAVEARKILDSVIAFSSLSLLSVFLFIIMKAPDVAITEASVGAGLTTAVLLIT:Sequence : XXXXXXXXXXXXXXXXXX :SEG|18->35|sviafsslsllsvflfii 61: . . . * . .: 120 :LFKMGKDDER :Sequence