[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD36283.1 tmar0 AAD36283.1 "conserved hypothetical protein"
MMLIAAFFAVEARKILDSVIAFSSLSLLSVFLFIIMKAPDVAITEASVGAGLTTAVLLIT
LFKMGKDDER
//