[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36465.1"

            "conserved hypothetical protein"
HSLO_THEMA  "RecName: Full=33 kDa chaperonin;AltName: Full=Heat shock protein 33 homolog;         Short=HSP33;"

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------1-1--------------------------------------------------------------11111111111111111111111111-11111-11111111111-11111111111111111111111111111121111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-12111-2111--1-1-1111-11-1-1111---1----11--1-11-1-------------------------11-----------11--1----------------1-----1--------------------------------1---11111111111111111111111111111------------11-------------1111---------1-1-1-1-1--------11111111111-111-----------------------------111--1--11--111111111111111111---1---------1111-1-1111111111-1111111111111111111111111111111111111111111111111111-111111111111---1-----11111--1-11111-11111111-------111--------111----1--------------11111111111111------------------111111--------1-1----1---11---111-1-------1--111-111--- ------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------11118111112-----311----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIYYGTMFDHKVRFSIVRMREVVEEARNRHALSYLATVVLGRALIGAALVTPWLAEKERW:Sequence :EEEEEEETTTTEEEEEEEcHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHGGGccTTcEE:Sec Str :============================================================:RP:SCP|1->230|1vq0A1|2e-85|100.0|230/230|d.193.1.1 :============================================================:BL:SWS|1->290|HSLO_THEMA|e-159|100.0|290/290 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->272|PF01430|5e-49|43.3|261/277|HSP33 61: . . . * . .: 120 :TLDIEGNGPIRRVVAQSTSEFTVRGYVANPKVELPLNEKGKFDVAGAIGQGVLRVVRDLG:Sequence :EEEEEEccTTcEEEEEEETTcEEEEEEccTTccccccTTccccHHHHHccEEEEEEEEcc:Sec Str :============================================================:RP:SCP|1->230|1vq0A1|2e-85|100.0|230/230|d.193.1.1 :============================================================:BL:SWS|1->290|HSLO_THEMA|e-159|100.0|290/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->272|PF01430|5e-49|43.3|261/277|HSP33 121: . . + . . .: 180 :LKTPFVSQVPLVSGEIAEDLAYYFAVSEQIPSAFSIGVLVDSDGVKIAGGFAVQIIDRTL:Sequence :ccccEEEEEEccccccHHHHHHHHHHHTcccEEEEEEEEEETTEEEEEEEEEEEEccTTc:Sec Str :============================================================:RP:SCP|1->230|1vq0A1|2e-85|100.0|230/230|d.193.1.1 :============================================================:BL:SWS|1->290|HSLO_THEMA|e-159|100.0|290/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->272|PF01430|5e-49|43.3|261/277|HSP33 181: . * . . . .: 240 :EQEKVEMIEKNIKNLPSISKLFQEAEPLDVLERIFGEKVGFVETAEIKYKCDCNREKAKN:Sequence :cHHHHHHHHHHHHTcccHHHHTTTccHHHHHHHHHcccccccEEEEcEEcccccHHHHHH:Sec Str :================================================== :RP:SCP|1->230|1vq0A1|2e-85|100.0|230/230|d.193.1.1 : ==========:RP:SCP|231->287|1vq0A2|7e-17|86.0|57/57|g.81.1.1 :============================================================:BL:SWS|1->290|HSLO_THEMA|e-159|100.0|290/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|9->272|PF01430|5e-49|43.3|261/277|HSP33 241: + . . . . *: 300 :ALLVLDKKELEDMRKEGKGEVVCKWCNTRYVFSEEELEELLKFKVDDSGS :Sequence :HHHTccHHHHHHHHHHTcEEEEcTTTccEEEEcHHHHHHHHHHHHHc :Sec Str : XXXXXXXX :SEG|274->281|eeeleell :=============================================== :RP:SCP|231->287|1vq0A2|7e-17|86.0|57/57|g.81.1.1 :================================================== :BL:SWS|1->290|HSLO_THEMA|e-159|100.0|290/290 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|9->272|PF01430|5e-49|43.3|261/277|HSP33