[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36480.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -----------------------------------------------------------------------1---1----------------------------------------------------------------------------------------------------------------------------1---1---1---------------1------1------------------------------------------------------1-------------------------------1-------1--------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111-11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKFLLLILVLLAFPFFSKTLLLYKGSEGGYGYNILSWLAPEPEVLGEDYEFVDVEKSLP:Sequence : cEEEEEE ccccHHHHHHHHHHHHHHHHTTcEEEEEcHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|4->17|flllilvllafpff 61: . . . * . .: 120 :DFEDYDFVITCYYSSSMPGAKKYLKKLVDFLLNGGKLFIINNLGAFEDSSGDNPSLSDIN:Sequence :HHHHccEEEEEEccTcccHH HHHHHHHHHHHTcTTTcccccccTTccc :Sec Str : $$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 121: . . + . . .: 180 :TLLNLLGVSFRYGWRQETVFSYEIEDGYLIKLPSFPVKKAFDGFEVFSSNVKIVSYAVTK:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 181: . * . . . .: 240 :KGKHPVIFYGPFGGMALFDHAFNENGEPVVDLRKIVMDIVGGYRENKVLMLDENHHIRKM:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 241: + . . . . *: 300 :FEYALFEVDSSRSGVLQKYRAIVIPDVSFLEEKEIKSYLENGGVVILVGSGTHYIQGEVV:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 301: . . . . + .: 360 :LEKENLYIPQDITVGERKVGYIPAPENAKAFITISGTPVSWMEKREKGAFVFFPEDLLEK:Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 361: . . . * . .: 420 :WSRGILFNEFLEASDFVISPMVNAFSVFLDDFPLPAYGIEYDILGTTDEIFYYKIWWRDM:Sequence : :Sec Str : ====:RP:SCP|417->648|1k1wA3|9e-04|12.1|206/293|c.6.2.2 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 421: . . + . . .: 480 :KELCEDFSIKPITALVTSYEQKTDYNGFFEFLEKDSSLKVLKNLIEDERVDTGIHGYNHV:Sequence : :Sec Str :============================================================:RP:SCP|417->648|1k1wA3|9e-04|12.1|206/293|c.6.2.2 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 481: . * . . . .: 540 :PPKSENWDLEELGKAYKSLRIFLSQLSSSYEPVAFVAPNNEIDQAGIEVLKSVFPTIKVI:Sequence : :Sec Str :============================================================:RP:SCP|417->648|1k1wA3|9e-04|12.1|206/293|c.6.2.2 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 541: + . . . . *: 600 :GTAYSLKDSTGEFTLLDDALILPRTTSGCYPLQRLLMETVSTLLNLGTYHHFSHPDDVIS:Sequence : :Sec Str :============================================================:RP:SCP|417->648|1k1wA3|9e-04|12.1|206/293|c.6.2.2 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 601: . . . . + .: 660 :LDRNPERYSWNEMFDQLRSFFRIMKENYPWLRNMDSKELYNTFKDYFENKPRILYHDKKI:Sequence : :Sec Str :================================================ :RP:SCP|417->648|1k1wA3|9e-04|12.1|206/293|c.6.2.2 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194 661: . . . * . .: 720 :VIVLPRTAELPRYFFLKAKGDVNVHGGVILFRDKDLCVVEMREYKMEISEVIEDGR :Sequence : :Sec Str :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|116->696|PF09960|2e-83|43.8|516/571|DUF2194