[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36720.1"

            "pyrimidine-nucleoside phosphorylase"
            ""

OrgPattern --1--1----------1------2-------1---111111111111111111-1111111------- 1-1-11------1-11111-31--1111111111111111-11111111111111112--1111211111--------1---1---------------------11--1-------------------------1-1-1-----1--------------------------------------1111111-111222222221222222111111222111111111111111111111111111111111111-1-11-------11111-----111---111111111111111111-------------11133-11111111-1111111111111111111111-11-11111111111111111-11-1---2-------1111--111-1------------11-11-11211-1111111111111---11111111211--------------1--------------------------------1-1-------1111--1-11----1111-11--122---2211--2---11---------1--------------1-----------------------111111-----------------------------112---11--11111111111111111111--1----------11111111111111111-1111111111111111111111111-11111111111111111111111111-1--112211111---2------1111-11-----------------------------------------1-------------11111111111111--------------------------------1-1----1-11121111111111111111111111111-2- ------1-------------------------------------------------------------------------------------------------------112111-1--111-121217C1-113-1-1--1---111-1--11--11----512-------1------------------11----- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRAYDVILKKRNGEKLSREEIEFMVGGYVKGEIPDYQMAAFLMAVYFRHLDEEETYYFTE:Sequence :ccHHHHHHHHHTTccccHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHcccHHHHHHHHH:Sec Str : XXXXXXXXX:SEG|52->61|eeetyyftet :============================================================:RP:SCP|1->69|1azyA1|9e-14|34.8|69/70|a.46.2.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->45|PF02885|7e-04|46.5|43/65|Glycos_trans_3N 61: . . . * . .: 120 :TMMRSGEVLDLSEIPGTKVDKHSTGGVGDKTTLVVAPLVASAGVPVAKMSGRALGHTGGT:Sequence :HHHHTccccccTTcccccEEEEEcccccccHHHHHHHHHHTTTccEEEEEccccTTcccH:Sec Str :X :SEG|52->61|eeetyyftet : ###########:PROS|110->125|PS00647|THYMID_PHOSPHORYLASE|PDOC00557| :========= :RP:SCP|1->69|1azyA1|9e-14|34.8|69/70|a.46.2.1 : ===============================================:RP:SCP|74->330|1azyA2|4e-98|45.9|257/265|c.27.1.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->267|PF00591|2e-23|41.3|189/252|Glycos_transf_3 121: . . + . . .: 180 :IDKLESIPGFRTELSLEEFIKNVKKYGIAIVGQTGNLVPADKKIYALRDATATVDEISLI:Sequence :HHHHTTcTTccccccHHHHHHHHHHHcEEEEEccTTccHHHHHHHHHHHHHTccccHHHH:Sec Str :##### :PROS|110->125|PS00647|THYMID_PHOSPHORYLASE|PDOC00557| :============================================================:RP:SCP|74->330|1azyA2|4e-98|45.9|257/265|c.27.1.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->267|PF00591|2e-23|41.3|189/252|Glycos_transf_3 181: . * . . . .: 240 :ASSIMSKKLAGGSDAFVLDVKFGTGAFMKGFEDAKKLAFLMLRIAQQHGKKAVAVLSNMD:Sequence :HHHHHHHHHHHcccEEEEEEEEcTTcccccHHHHHHHHHHHHHHHHHTTcEEEEEEEEcc:Sec Str :============================================================:RP:SCP|74->330|1azyA2|4e-98|45.9|257/265|c.27.1.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->267|PF00591|2e-23|41.3|189/252|Glycos_transf_3 241: + . . . . *: 300 :QPLGKAVGNSLEVIEAIETLKGNGPEDLKELSLTLGALMLELAGVADFEEGKKILQEKLE:Sequence :cccccEEccHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|74->330|1azyA2|4e-98|45.9|257/265|c.27.1.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 :$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|75->267|PF00591|2e-23|41.3|189/252|Glycos_transf_3 301: . . . . + .: 360 :TGEALDKFRLLVKAQGGNERVVDDPWRVLPVAEQVVEFSAAREGFVSKIDAEKVGIASMM:Sequence :HTHHHHHHHHHHHHTTccGGGTTcGGGGcccccEEEEEEccccEEEEEEcHHHHHHHHHH:Sec Str :============================== :RP:SCP|74->330|1azyA2|4e-98|45.9|257/265|c.27.1.1 : =============================:RP:SCP|332->434|1azyA3|3e-11|32.0|103/105|d.41.3.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 : $$$$$$$$$$$$$$$$:RP:PFM|345->419|PF07831|1e-16|53.3|75/75|PYNP_C 361: . . . * . .: 420 :LGAGRKKKEDRIDHSVGIIVEKKLGDSVKKGEAIARLFVSDRSDVESALKLLKEAYVISD:Sequence :HTTccccTTccccTTcEEEEcccTTcEEcTTcEEEEEEEcccccHHHHHHHHTTEEEEEc:Sec Str :============================================================:RP:SCP|332->434|1azyA3|3e-11|32.0|103/105|d.41.3.1 :============================================================:BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|345->419|PF07831|1e-16|53.3|75/75|PYNP_C 421: . . + . . .: 480 :SPSEPPRVVEEVIK :Sequence :ccccccccEEEEE :Sec Str :============== :RP:SCP|332->434|1azyA3|3e-11|32.0|103/105|d.41.3.1 :============= :BL:SWS|1->433|PDP_BACST|e-116|51.0|431/433