[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36800.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111-211----1-1-----------------------1-11-1111-----------12212223311-11-1-22111111-11-11-11------1112----------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--------211-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------111-------111---1--2-211------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------1111111111--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNSFSSKNPEGCSLKVLIKYLLKLSVVPFLIGLGGFIVFVSLEILYQLSDLIVRHRVGIE:Sequence 61: . . . * . .: 120 :KLFLMLYYYLPYFVAMGVPVGVLLAIFWTFSRLSEERELMAIQVHGISQKNLIVPFLILG:Sequence : XXXXXXXXXXXX :SEG|62->73|lflmlyyylpyf : ====================================:BL:SWS|85->172|Y871_RICPR|4e-04|26.6|79/360 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->362|PF03739|2e-32|30.2|285/354|YjgP_YjgQ 121: . . + . . .: 180 :ALLSIAVFFLSDQIVPEYQSKAEEAMSKYVLKKPEVFVVENVISKIGDDQYFYVEKYDER:Sequence :==================================================== :BL:SWS|85->172|Y871_RICPR|4e-04|26.6|79/360 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->362|PF03739|2e-32|30.2|285/354|YjgP_YjgQ 181: . * . . . .: 240 :TSTMWNVVIFRYGHEETIVTAKRVQKKGNDWYLFDGNYYTVDKDGFLKLDVHFSEMKLDI:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->362|PF03739|2e-32|30.2|285/354|YjgP_YjgQ 241: + . . . . *: 300 :TEDIEKLLRVGKTPKEMTGKELKEKIEFFKKVGVKPSPWVVELHSRYANSLTPIVIVLVG:Sequence : XXXXXXXXXXXX :SEG|260->271|kelkekieffkk :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->362|PF03739|2e-32|30.2|285/354|YjgP_YjgQ 301: . . . . + .: 360 :VPLSLLFQLRSKSWGVIFTFVLVVLYQGSGAWLSAMGKENLLNPVLAPWIPNIVFTIVGT:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|78->362|PF03739|2e-32|30.2|285/354|YjgP_YjgQ 361: . . . * . .: 420 :LLFILLDTFFAYRITEFLSRLFFVAFIFTVSSLFSSQVVIVSDRMEKFPEEMVFHGSVEI:Sequence : ==========================:BL:SWS|395->591|LPTD_PSEA6|1e-05|25.6|176/759 :$$ :RP:PFM|78->362|PF03739|2e-32|30.2|285/354|YjgP_YjgQ 421: . . + . . .: 480 :AYKDMTVQASEATIQLTEEGKAKKLEASGGVIYRKADTILMGEHLIFYLENEKSVLTHIR:Sequence :============================================================:BL:SWS|395->591|LPTD_PSEA6|1e-05|25.6|176/759 481: . * . . . .: 540 :GSTVLEIEKEKKKIYLSGEDLTSEGSRTIVDMGSISTCSETPPHYKLKARYIEIKENDYL:Sequence : XXXXXXXXX :SEG|486->494|eiekekkki :============================================================:BL:SWS|395->591|LPTD_PSEA6|1e-05|25.6|176/759 541: + . . . . *: 600 :LAKDVVFYLLEIPLFYQPIFFTSLSDKPQPFSVEVGVGNNPHLKTSYNVSYPSGLLYFST:Sequence :=================================================== :BL:SWS|395->591|LPTD_PSEA6|1e-05|25.6|176/759 601: . . . . + .: 660 :KSVLSGGLSKELNWNHKMGSWSLNLDYKESTSHSVLVKIFDSKNTFLFSQKNEERIHQFE:Sequence 661: . . . * . .: 720 :RKEKILNGSLNVVLRKESDGEDSYILPRVTVKKVSVKTGVGTFSVDSFNHETRIEDQEKR:Sequence : XXXXXXXXXXXXXX :SEG|689->702|vtvkkvsvktgvgt 721: . . + . . .: 780 :NSGSVSLSFRSVPFLLFQSVSVSTTGKYLFENQNLDERTSYLKTDSIWDFQNLSLGKFLV:Sequence 781: . * . . . .: 840 :LDDKIYAGVYRSNEDGYRVGNLFTTTLRVPLGPFSFESYYKLFTVSGENLRKFSQNESKN:Sequence : ========================================:BL:SWS|801->913|FENR_BUCAP|8e-04|28.7|108/100 841: + . . . . *: 900 :EVDLKVSFSYENFKSSLETTYDFLEKEFSDPYLKTSYSFKTGDITHTVDSTTRFVLDEIS:Sequence :============================================================:BL:SWS|801->913|FENR_BUCAP|8e-04|28.7|108/100 901: . . . . + .: 960 :RSYTTWNFQQRMGAFLNRFYFTYYYREPHVKYVEDQMRIYGKNFLFMENPRITTYTKLSV:Sequence :============= :BL:SWS|801->913|FENR_BUCAP|8e-04|28.7|108/100 961: . . . * . .:1020 :DPFELDEFWIRGTFKKGESTHSLKMSYSSDNLEFSYQTKNGDPALEISFSLKDWNVEKFS:Sequence 1021: . . + . . .:1080 :LSVEKALHCLGTKISTSFGRNFTLESFSILFFIRDFPNSGIGFDTEEGIGLNVF :Sequence