[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36835.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---1-1111111111----------------------1----------1---1-------1-1---1-----------11111--------------------------------------------------------1111111-------------------------------------1111111--11111111111111111111111111111111122222211111111111111111111111111111111111111111111121211111111111111111111111111111111111111111111111111111111111-111111111-11111-111-1-1111-1111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------------------------------------------------------211111-1111111---1111111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MFPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILR:Sequence : TTccccHHHHHHHHHHHHHHHccccTTccHHHHHHHHHHHHHHHcccTHHHHHHHHHH:Sec Str : ==========================================================:RP:SCP|3->167|3cr3A1|1e-32|20.4|152/192|a.208.1.1 :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->163|PF02734|8e-18|40.9|159/173|Dak2 61: . . . * . .: 120 :GMADASPREYITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEE:Sequence :HHHHHccccETTcccHHHHHHHHHHHHHHHcccTTcccHHHHHHHHHHHHHHHHHHTTcc:Sec Str :============================================================:RP:SCP|3->167|3cr3A1|1e-32|20.4|152/192|a.208.1.1 :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->163|PF02734|8e-18|40.9|159/173|Dak2 121: . . + . . .: 180 :LFDWIVEIARDTVNRTPHMLQKLREAGVVDAGAKGLYYIFEGMRDAVKGNIQVNLEEVEQ:Sequence :HHHHcHHHHHHHHHHGGGcccccGGTTcccHHHHHHHHHHHHHHHHHcGGTTcTTccTcH:Sec Str :=============================================== :RP:SCP|3->167|3cr3A1|1e-32|20.4|152/192|a.208.1.1 :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->163|PF02734|8e-18|40.9|159/173|Dak2 181: . * . . . .: 240 :ASVEELQRMAFEEITNRYCTEVAVRRNQVVEKSELEAFLNEIGDSVVLVEQDDLIKLHVH:Sequence :HHHHHHHHHHHTccccccccHHHHHHHHHHHHcTTccEEEEEccHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 241: + . . . . *: 300 :TNHPGQVLEKVIEFGEIVKVKIDNMKLQHEHVISTQPTKEIGVVAVSPGKGISDILKSLG:Sequence :cccEEEEETTccccccGGGcEEcccccccccEEccTTcccEEEEEEEccHHHHHHHHHHE:Sec Str :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 301: . . . . + .: 360 :VDVIVPGGQTMNPSFADLKAAVEQTHAKNVFLFPNNANVLLTAKQIAEAFDDRRVIVVPT:Sequence :EEEEccTTccccccHHHHHHHHHHccccEEEEEEccGGGHHHHHHHHHTcccHEEEEccc:Sec Str : =======================:RP:SCP|338->486|1pzxA|7e-04|12.6|143/278|c.119.1.1 :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 361: . . . * . .: 420 :SFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF:Sequence :cHHHHHHHHHHHHHTTccHHHHHHHHGGGccccccccccEEccccHHHHHHTTcEEEEEE:Sec Str :============================================================:RP:SCP|338->486|1pzxA|7e-04|12.6|143/278|c.119.1.1 :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 421: . . + . . .: 480 :VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDL:Sequence :ETTEEEEEEEEccHHHHHHHHHHHTTcccEEEEEEEcccTHHHHHHHHHHHHccccEEEE:Sec Str :============================================================:RP:SCP|338->486|1pzxA|7e-04|12.6|143/278|c.119.1.1 :============================================================:BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548 481: . * . . . .: 540 :EIYEGGQPHYPYLMLLQ :Sequence :EEEEccHHHHHHH :Sec Str :====== :RP:SCP|338->486|1pzxA|7e-04|12.6|143/278|c.119.1.1 :================= :BL:SWS|1->497|Y1202_STAAR|5e-88|36.6|489/548