[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD36835.1 tmar0 AAD36835.1 "conserved hypothetical protein"
MFPVPDGDTGSNMCSTMLEACKYIDNVKSDDLIEVWKAVKEGALMGARGNSGVILSQILR
GMADASPREYITPADFVKMISNARKVAYSAVMRPVEGTMLTVVRVLDERLQGKNFETFEE
LFDWIVEIARDTVNRTPHMLQKLREAGVVDAGAKGLYYIFEGMRDAVKGNIQVNLEEVEQ
ASVEELQRMAFEEITNRYCTEVAVRRNQVVEKSELEAFLNEIGDSVVLVEQDDLIKLHVH
TNHPGQVLEKVIEFGEIVKVKIDNMKLQHEHVISTQPTKEIGVVAVSPGKGISDILKSLG
VDVIVPGGQTMNPSFADLKAAVEQTHAKNVFLFPNNANVLLTAKQIAEAFDDRRVIVVPT
SFVQECVAAMVEYDPDAEPEDLLKRFEEAISQCVPISVTRAVRDSRYGNRRIRKGEYLLF
VRKELVSHGFSLVKVLKEALEKENAHEKEILTVFLGDNYRKPELEKIQKLIGEEFPNLDL
EIYEGGQPHYPYLMLLQ
//