[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36863.1"

            "hypothetical protein"
            ""

OrgPattern ---------------------------1-----1---1----1-----1---1--------------- ----------------------------------------------------------------------------------1---1-----------------------------------------------------------------------------------------------------11----------------------------1--------------------------------------------------------------------------------------------------------1------------------------1------------1----11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-111----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKVLVFDVSAPYALFRRPYTTTSSYTLPFPPRTTLLGLVGCVLGYSTPERLDSAKVAVQI:Sequence : XXXXXXXXXX :SEG|35->44|llglvgcvlg : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->167|PF09704|8e-04|30.4|161/189|Cas_Cas5d 61: . . . * . .: 120 :KNPLKFLRTGTNFVETKKDKKASKRTRISLQLLKNPAYRVFFSWEDEDFERLKNLLEHSE:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->167|PF09704|8e-04|30.4|161/189|Cas_Cas5d 121: . . + . . .: 180 :TIFTPYLGVASFIARLNYVGKYEATRVADFPCEVHTVVPNTVKLLPEPSHYLIFERVTRK:Sequence :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->167|PF09704|8e-04|30.4|161/189|Cas_Cas5d 181: . * . . . .: 240 :MDKERNMLESAVYIFKRDLSPVKVEGGEVWRVGEQNIVWM :Sequence