[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAD36863.1 tmar0 AAD36863.1 "hypothetical protein"
MKVLVFDVSAPYALFRRPYTTTSSYTLPFPPRTTLLGLVGCVLGYSTPERLDSAKVAVQI
KNPLKFLRTGTNFVETKKDKKASKRTRISLQLLKNPAYRVFFSWEDEDFERLKNLLEHSE
TIFTPYLGVASFIARLNYVGKYEATRVADFPCEVHTVVPNTVKLLPEPSHYLIFERVTRK
MDKERNMLESAVYIFKRDLSPVKVEGGEVWRVGEQNIVWM
//