[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tmar0:AAD36879.1"

            "conserved hypothetical protein"
            ""

OrgPattern --1-----------------1111-----1----1----------12112111---11111------- ------------------------------------------------------------------------------------------------------------------------------1--1-111-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---1111111-1-----1--------1----11131-11-1-111----1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11--1----------------11------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1121211--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIIAIPVSENRGKDSPISEHFGRAPYFAFVKVKNNAIADISVEENPLAQDHVHGAVPNFV:Sequence :cEEEcEEccccGGGccccccGGGccEEEEEEccTTccccEEEEEcTTccccccTHHHHHH:Sec Str : ===========================================================:RP:SCP|2->107|1o13A|5e-36|99.1|106/107|c.55.5.1 :============================================================:BL:SWS|1->109|Y580_METJA|3e-07|28.2|103/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|17->100|PF02579|2e-05|34.9|83/94|Nitro_FeMo-Co 61: . . . * . .: 120 :KEKGAELVIVRGIGRRAIAAFEAMGVKVIKGASGTVEEVVNQYLSGQLKDSDYEVHDHHH:Sequence :TTTTccEEEEccccHHHHHHHHHHTcEEEEcccccHHHHHHHHHTTccccccccc :Sec Str : XXXXX:SEG|116->123|hdhhhheh :=============================================== :RP:SCP|2->107|1o13A|5e-36|99.1|106/107|c.55.5.1 :================================================= :BL:SWS|1->109|Y580_METJA|3e-07|28.2|103/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|17->100|PF02579|2e-05|34.9|83/94|Nitro_FeMo-Co 121: . . + . . .: 180 :HEHH :Sequence : :Sec Str :XXX :SEG|116->123|hdhhhheh