[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80359.1"

            "sugar ABC transporter, periplasmic sugar-binding protein, putative"
            ""

OrgPattern ------------------------2111---------------------------------------- ----4--1111-1--111-------111111------1111112362-1432423--1----11112232---1131-----------------------------------------------------------11111----11--1---1-----------11222-------------55-5411-5212222212211222223122--223112---13233225B--------------------12--44--232----44---1-1----------2--12212221112-------------1----------1-121111121111-2-----1---211----------4--1541-1---------1-11---423---2-2--33432342436------1-114--69967568685611---1211211232--------1------------------------------------------122221111111111111221111111121111----1--12221-221-------1----------------1--------1111---------11--11----------1-------------------1--------1--------------------------------1134-111111111111-111111111111111111134344--111111111111111111-11111---133333333323---------1111---11--------------1---------------------1----211--------------111111-111------------------------------------------------------------2654256444--- -------------1-----------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKALLLVAALGVAFAQQAKPEDVIKEQCARAKVVAEFWHGFTGGAPKAALENLVVEFNK:Sequence : ccccccEEEEccccTTccHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXXXXXX :SEG|4->19|alllvaalgvafaqqa : ========================:RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 : ===============================:BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438 : $$$$$$$$$$$$$$$$$:RP:PFM|44->325|PF01547|3e-22|37.3|263/282|SBP_bac_1 61: . . . * . .: 120 :AQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVR:Sequence :HHHcccEEEEcccccTTHHHHHHHHGGGTccccEEEEEGGGHHHHHHTTccccccccHHH:Sec Str :============================================================:RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 :============================================================:BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->325|PF01547|3e-22|37.3|263/282|SBP_bac_1 121: . . + . . .: 180 :LQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSR:Sequence :HTTccHHHHGGGEETTEEccEEEEEEccEEEEETTTccccTcccccccTTHHHHHHHHHT:Sec Str : ################## :PROS|142->159|PS01037|SBP_BACTERIAL_1|PDOC00796| :============================================================:RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 :============================================================:BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->325|PF01547|3e-22|37.3|263/282|SBP_bac_1 181: . * . . . .: 240 :AEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKPIT:Sequence :TTccccccccccHHHHHHHHHHTTccccccccEEcccHHHHHHHHHHHHHHHTTcccTcc:Sec Str :============================================================:RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 :============================================================:BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->325|PF01547|3e-22|37.3|263/282|SBP_bac_1 241: + . . . . *: 300 :SGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPGRTKGQPGYGLVQGTNLVVF:Sequence :HHHHHHHHHTTcccEEEEEcGGGHHHHHHHTccEEEEccccccTTcccccEEEEEEEEEc:Sec Str :============================================================:RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 :============================================================:BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|44->325|PF01547|3e-22|37.3|263/282|SBP_bac_1 301: . . . . + .: 360 :RQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYAAENPDYATIV:Sequence :TTcccTTHHHHHHHHHHTTccHHHHHHHHHHccccEEccHHHHHHHHHHHTTcHHHHHHH:Sec Str :============================================================:RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 :============================================================:BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|44->325|PF01547|3e-22|37.3|263/282|SBP_bac_1 361: . . . * . .: 420 :RQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSRTR :Sequence :HHHHHcEEccccTTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHccHHHHcTTc :Sec Str :==================================================== :RP:SCP|37->412|1urdA|3e-40|18.8|361/370|c.94.1.1 :==================================================== :BL:SWS|30->412|UGPB_SALCH|1e-26|30.3|380/438