[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80359.1 tthe0 AAS80359.1 "sugar ABC transporter, periplasmic sugar-binding protein, putative"
MKKALLLVAALGVAFAQQAKPEDVIKEQCARAKVVAEFWHGFTGGAPKAALENLVVEFNK
AQQGRCVRPVPQGGYRDLSTKIKAAFAAGKVPAMAQAFENNIALYLEAKALLPIESLGVR
LQGVNLTFLNAVRFGGVVYGVPFNKSIQVLYYNKDLLKKHGVPVPATLEEFVAAAKKLSR
AEGGPVYWFQPDASTFAYFFFNLGGSYLKDGKLVLNSKEAVEALTLLQNGVKEGWAKPIT
SGYINQNLGSGPYAFSVDTSAGYTYYLRAAKFDLGVATLPGRTKGQPGYGLVQGTNLVVF
RQASKEEQAVAKDFLEFVLSPRAQAVFATATGYVPVTEGALKDPVYQAYAAENPDYATIV
RQSRYAKFEPALAEWEQIRFDILGQAIKEAILNKADPKAALDRAQKLAEDLLSSRTR
//