[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80360.1"

            "probable tungsten-containing aldehyde ferredoxin oxidoreductase"
            ""

OrgPattern 112224----------463442242-----34------------11111-313-4453346-326--- -------------------------------------------------------------------------------122------------------------------------------------------21121---11----------------------------------------32---------------------------------------------------------------------------------------------------------------------------------------1321-1111111-1--------------3--1211-2A2-54311-14---3---------------------------------------------------------------------------------------2-1-------------------------------------------------------------------------11-11-1-1----1----------------21--5A31471152221-586142453------64---------------------2-----------------111---1---1--1-11-----1--------1-1----1111111111-111111-11111111111--------1-----------------1--1-11-----------------------------------------------------------------------------------------------------------------------------------------------------------------11---2------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MPKGYHDRVAFVDLSTGKVWYESFGEAFWRRYLGGRALAAYLLLRHVPKGADPLGPENAL:Sequence : ccccEEEEEETTTTEEEEEEccHHHHHHHccTHHHHHHHHHHHccTTccTTcTTccE:Sec Str : XXXXXXXXXXXXXXXX :SEG|30->45|rrylggralaaylllr : =========================================================:RP:SCP|4->208|1aorA2|2e-53|38.5|205/210|d.152.1.1 : =========================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->204|PF02730|1e-42|47.0|200/203|AFOR_N 61: . . . * . .: 120 :VFAPGILTGTPISGSGRNTVAAKSPLTGGYGDAEGGGFFGAELKNAGLDALVVLGQAEAP:Sequence :EEEEcTTTTcccTTcccEEEEEEcTTTccEEEEEEcccHHHHHHHTTccEEEEEcccccc:Sec Str : XXXXXXXXXXXXXXX :SEG|88->102|ggygdaegggffgae :============================================================:RP:SCP|4->208|1aorA2|2e-53|38.5|205/210|d.152.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->204|PF02730|1e-42|47.0|200/203|AFOR_N 121: . . + . . .: 180 :VYLHVEGGKVALHPAVHLWGKDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDL:Sequence :EEEEEETTEEEEEEcTTTTTccHHHHHHHHHHHTccccEEEEccHHHHTTcTTccEEETT:Sec Str :============================================================:RP:SCP|4->208|1aorA2|2e-53|38.5|205/210|d.152.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|5->204|PF02730|1e-42|47.0|200/203|AFOR_N 181: . * . . . .: 240 :AHFAGRGGLGAVMGAKRLKAVSARAHKETLPAYHDPGLLKELARRMAKERMDRAAGLVTM:Sequence :TEEEccccHHHHHHHTTEEEEEEEcccccccccccHHHHHHHHHHHHHHcHHHHTHHHHH:Sec Str :============================ :RP:SCP|4->208|1aorA2|2e-53|38.5|205/210|d.152.1.1 : ==========================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|5->204|PF02730|1e-42|47.0|200/203|AFOR_N : $$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 241: + . . . . *: 300 :GTVGTVKPFNLRGVLPSHNFLDGFSEGAEALDGTSLDALGIRIGRDTCYACAIRCKQVVK:Sequence :cGGGHHHHHHHTTccccTTTTccccTTGGGGcHHHHHHHTEEEEEccTTcccccEEEEEE:Sec Str :============================================================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 301: . . . . + .: 360 :IEGTGKYDVRPEYGGPEYEGLGALGSTCGVTDPYAVTKANTLCNQYGLDVIGVGVTIACA:Sequence :TTTEEEEcccHHHHHHHTGGGTcccHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHTT:Sec Str : XXXXXXXXXXXXXXX :SEG|311->325|peyggpeyeglgalg :============================================================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 361: . . . * . .: 420 :MEAVEKGYLDDEGLGLRFGNGDALIAAIEKLARREGRLGELLAQGAKRLAESLGHPELAM:Sequence :cccHHHHTTcccccTTcTHHHHHHHHHHHTTcTTHHHHTTcHHHHHHHTTcGGGccEETT:Sec Str : XXXXXXXXXXXXXXXXXX :SEG|389->406|eklarregrlgellaqga :============================================================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 421: . . + . . .: 480 :HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPL:Sequence :EEcccccGGGcHHHcHHHHHHHHHcTTccccGGGcTHHHHTTcccccccTTcHTccTTcc:Sec Str :============================================================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 481: . * . . . .: 540 :PIEDLSEAKIRMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVG:Sequence :cHHHHHHHHHHHHHHHHHHHHTccGGGGTcHHTccHHHHHHHHHHHHTccccHHHHHHHH:Sec Str :============================================================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 541: + . . . . *: 600 :ERTLQLTRLFNLREGISPEEDRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEG:Sequence :HHHHHHHHHHHHHHTccHHHHccccHHHHHccccccTTTTccccHHHHHHHHHHHHTcTc:Sec Str :============================================================:RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :============================================================:BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C 601: . . . . + .: 660 :GVDPERLRALGLEEFQNALA :Sequence :cccHHHHHHHTcGGG :Sec Str :=============== :RP:SCP|215->615|1b25A1|2e-43|25.5|377/401|a.110.1.1 :=============== :BL:SWS|4->615|AOR_PYRKO|8e-76|34.8|589/605 :$$$$$$$$$$$$ :RP:PFM|223->612|PF01314|1e-53|39.0|364/381|AFOR_C