[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80391.1"

            "alpha-aminodipate aminotransferase"
            ""

OrgPattern 4432324244444443462322231--1232-1--1112222242-3431122-33355641114-11 435-A221221-2-711----2---5------322255862523462223315673241145435176662222222222-523132111-113-------5--1815-1----------------2-212-22-323344222353-22---222211----22-23321-------1----3652321162777878B9B5998BB948875A8AB554C124211111LA122121222222222211-421322222-2-4444221111411121111111233222212222221111111111111233111333246367AAA9AAA59537553454623--331225434213-43334313-11-4223------2A7511-3323144434455458-224366573A2-544444957688621-1328322425A333333331441-336------------------------------21313FC98EKHIIHLFBBB9LLOQDDDD5ALFIFEIF--9AB56433J885B6572253463-------113453-5312154266A94-42311222-433467132---1111111----------21-311523-313-112-5333--12123-1123-4---3362------58961884554444434-5434434424554224226ABBA92324355545444444454B22522221-75554535554511-------2111329681231-2-11--111-776764412243BACAEFBB9ECDB6668---------22114222224675444221221111111113144----------------------------------------3322122222151 ----241-----122243454534444342222432333333222243261465213121--32232413334333312333332222-35243415243312313-2626121112111-11121-21342-11111-111111-111111-1-112234523411121E--521-1-D---24411C33-1242222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKPLSWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARIL:Sequence :cccccHHHHccTTHHHHccccccHHHHcccccccEEcccccccGGGcccHHHHHHHHHHH:Sec Str : XXXXXXXX :SEG|50->57|eeaaeaaa : =========================================================:RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 : ============================================:BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 61: . . . * . .: 120 :REKGEVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLL:Sequence :HHHHHHHcccccTTccHHHHHHHHHHHTccGGGEEcccHHHHHHHHHHHHHccTTcEEEE:Sec Str :============================================================:RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 :============================================================:BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->377|PF00155|1e-27|37.1|302/341|Aminotran_1_2 121: . . + . . .: 180 :EAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLT:Sequence :EEcccHHHHHHHGGGccEEEEEEEETTEEcHHHHHHHHHHcccccEEEcTcTcTTTcccc:Sec Str :============================================================:RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 :============================================================:BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->377|PF00155|1e-27|37.1|302/341|Aminotran_1_2 181: . * . . . .: 240 :PLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVL:Sequence :cHHHHHHHHHHHHHHTccEEEEcTTTTccccccccccHHHHHHTTTcccEEEEEEcTTTT:Sec Str :============================================================:RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 :============================================================:BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->377|PF00155|1e-27|37.1|302/341|Aminotran_1_2 241: + . . . . *: 300 :SPGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGFSERLERVRRVYREK:Sequence :cGGGccEEEEccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHH:Sec Str : XXXXXXXXXXXX :SEG|288->299|erlervrrvyre :============================================================:RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 :============================================================:BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->377|PF00155|1e-27|37.1|302/341|Aminotran_1_2 301: . . . . + .: 360 :AQAMLHALDREVPKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEENVAFVPGGPFFAN:Sequence :HHHHHHHHHHHccTTcEEcccccccEEEEEccTTccHHHHHHHHHTTTEEcEEcGGGcTT:Sec Str :============================================================:RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 :============================================================:BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|68->377|PF00155|1e-27|37.1|302/341|Aminotran_1_2 361: . . . * . .: 420 :GGGENTLRLSYATLDREGIAEGVRRLGRALKGLLALV :Sequence :cccTTEEEEEcTTccHHHHHH :Sec Str : XXXXXXXXXXXXXXX :SEG|382->396|gvrrlgralkgllal :===================== :RP:SCP|4->381|1vp4A|7e-51|33.3|375/420|c.67.1.1 :===================== :BL:SWS|17->381|Y104_SULSO|2e-64|36.2|362/401 :$$$$$$$$$$$$$$$$$ :RP:PFM|68->377|PF00155|1e-27|37.1|302/341|Aminotran_1_2