[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80413.1 tthe0 AAS80413.1 "hypothetical protein"
MDRKGWVMRAVEALRLATFKEIQRYLDEEGEPFSKKELLDTLKALVAEGLLEEKEGVYRP
ARKKGSAEAFRRLFGD
//