[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80551.1"

            "probable small heat shock protein"
            ""

OrgPattern ------------------------------1-----------------1------------------- ----------------------------------------------------------------------1-----------3--111--------------------3------------------------------12----21------------------------------------1122221--1--------------------------------------------------------------------------------------------------------------------------------------------------------------1---1----1---1--------1-11---------11--------------------------1----1-------------------------------------------------------------------------------------------------------------------1---1-------------1-1---------111------11222---111--1-1121-11121--1-------------------------------------------------------------1111------------------------------------------------------------------------------------------------------1---------------------------------------------------------1----------------1-1--111--------------------------------------------------------------- ----------1---1-----------------------------------------------------------------------1----1--3-------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLERHDRLETLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRP:Sequence : ccccEEEccEEEEEcccEEEEEEEcTTccG:Sec Str : ==========================:RP:SCP|35->129|1wh0A|1e-15|17.9|95/134|b.15.1.3 : ==========================================================:BL:SWS|3->127|SP21_STIAU|1e-12|30.4|125/188 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->134|PF00011|1e-08|36.2|94/101|HSP20 61: . . . * . .: 120 :EDLELLEEGQRVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLE:Sequence :GGEEEEETTTEEEEEEccccccccccccccccccEEEEEEccccccGGGcEEEEETTEEE:Sec Str :============================================================:RP:SCP|35->129|1wh0A|1e-15|17.9|95/134|b.15.1.3 :============================================================:BL:SWS|3->127|SP21_STIAU|1e-12|30.4|125/188 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->134|PF00011|1e-08|36.2|94/101|HSP20 121: . . + . . .: 180 :VRFRKRPATALPLKEA :Sequence :EEEEcccc :Sec Str :========= :RP:SCP|35->129|1wh0A|1e-15|17.9|95/134|b.15.1.3 :======= :BL:SWS|3->127|SP21_STIAU|1e-12|30.4|125/188 :$$$$$$$$$$$$$$ :RP:PFM|41->134|PF00011|1e-08|36.2|94/101|HSP20