[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80551.1 tthe0 AAS80551.1 "probable small heat shock protein"
MLERHDRLETLRKLKELQERIAELAYLLTGEEPAAWTPRVDLLETEEHYVLLVDLPGVRP
EDLELLEEGQRVTLAGVRHPLPGTYLLEERPMGTFRRTLDLPGPIEEGTAQATLRNGVLE
VRFRKRPATALPLKEA
//