[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80555.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTARYVLTSACIQTGTMALTVSLRQRLLGREQVRFVDEDGEAYTVEVDWKAGVLRGLGPY:Sequence 61: . . . * . .: 120 :YQKRRLSANETVLLLFRGEEVELKAAPRPGQRPPAREREARPEEASPPPESQKRRVRVTP:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|85->110|aaprpgqrpparerearpeeaspppe 121: . . + . . .: 180 :YPKEVLFPHEPLEPPGATEDLRRLGFQLEEGPPWVYRAFSGRRRLTLVLLRLGEGEVERL:Sequence : XXXXXXXXXXXXXXXXXXXX:SEG|161->180|grrrltlvllrlgegeverl 181: . * . . . .: 240 :KPYRLQGAYTALLAPESQRDRVPEGVGFVSPEALTRLARLKGRFPLTPWDLEDLLKEGRV:Sequence 241: + . . . . *: 300 :DLEAVEALEDRLAAELSERGAFAALLLLLARKPLGEVFLLADLEAEALEEGLVPEVVRQG:Sequence : XXXXXXXX :SEG|263->270|aallllla : XXXXXXXXXXXXXXXXXXXXXX :SEG|276->297|evflladleaealeeglvpevv 301: . . . . + .: 360 :VEVLAQPPFLLLKRLSPGEFLLRQSVEEALEDLRAFAEGLAGRLSRARSL :Sequence