[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>AAS80555.1 tthe0 AAS80555.1 "hypothetical protein"
MTARYVLTSACIQTGTMALTVSLRQRLLGREQVRFVDEDGEAYTVEVDWKAGVLRGLGPY
YQKRRLSANETVLLLFRGEEVELKAAPRPGQRPPAREREARPEEASPPPESQKRRVRVTP
YPKEVLFPHEPLEPPGATEDLRRLGFQLEEGPPWVYRAFSGRRRLTLVLLRLGEGEVERL
KPYRLQGAYTALLAPESQRDRVPEGVGFVSPEALTRLARLKGRFPLTPWDLEDLLKEGRV
DLEAVEALEDRLAAELSERGAFAALLLLLARKPLGEVFLLADLEAEALEEGLVPEVVRQG
VEVLAQPPFLLLKRLSPGEFLLRQSVEEALEDLRAFAEGLAGRLSRARSL
//