[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "tthe0:AAS80557.1"

            "hypothetical conserved protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRALLHLLLFLALLPSLLALAPRLRAQAPGPVALVLDAEAVREEARARGEDLMAALARYQ:Sequence : XXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|2->29|rallhlllflallpsllalaprlraqap : XXXXXXXXXXXXXXXXX :SEG|32->48|valvldaeavreearar 61: . . . * . .: 120 :AFGVNGVAFPERLVRDWVGEGVLLYRQGRELVEMGLSARPGWHYLKGDPALLALLERAYD:Sequence 121: . . + . . .: 180 :LPSERLGEWLGFPVDVQALPAFYNLEELRQAKAMGLYVMVRPLNHRLRRLEAGLPLVPKE:Sequence 181: . * . . . .: 240 :ADAVVFQGLEALGYPYRLGEAKALVPVPVALIEGTPQAGLGAFRDKGILRLFSLRYEWLL:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|204->286|PF06745|2e-04|38.5|78/202|KaiC 241: + . . . . *: 300 :TLKPEEAAEKYGLAARERSHQILYLRPYPYPEDTARLLKRLQEELKASGLPLGAPSPRAL:Sequence : XXXXXXXXXXXX:SEG|289->344|glplgapspralapsplryaawvgvlaglgllalglpvygplvafllllfalgyag :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|204->286|PF06745|2e-04|38.5|78/202|KaiC 301: . . . . + .: 360 :APSPLRYAAWVGVLAGLGLLALGLPVYGPLVAFLLLLFALGYAGSQAGPLLAALVFPVLG:Sequence :XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX :SEG|289->344|glplgapspralapsplryaawvgvlaglgllalglpvygplvafllllfalgyag 361: . . . * . .: 420 :FLGPRNGLWMWARSLGYALLGAVFLSALGSTEEAIAGLAPFKGVSLTLLVPPLLVAYSFL:Sequence : XXXXXXXXXX :SEG|406->415|ltllvppllv 421: . . + . . .: 480 :EKDFKEALTRLFLHPARLGEVALGGLALGLLLLALLRRGNDAPIVPELELKLRALLQDVM:Sequence : XXXXXXXXXXXXXXXXXXXXXXXX :SEG|436->459|arlgevalgglalgllllallrrg 481: . * . . . .: 540 :VRPRFKEVFGHALFPLALLLPWPRWVQNGLLFLASLGIASILNTFSHYHTPLPISFFRVL:Sequence : XXXXXXXXXX :SEG|492->501|alfplalllp : XXX:SEG|538->561|rvlngallglslglvgvilvrrlr 541: + . . . . *: 600 :NGALLGLSLGLVGVILVRRLRAWWSA :Sequence :XXXXXXXXXXXXXXXXXXXXX :SEG|538->561|rvlngallglslglvgvilvrrlr